Visit

Bodysockstore.co.cc

Get a widget

www.bodysockstore.co.cc • Buy or Donate on Instagram

advertising
Popularity: Safety: Social signals: Legit: legal
Contact info Contact page mOYjDe@PRIVACYPOST.COM
Website Topics short links, tinyurl, bitly, bit.ly, earn money, link advertising, tiny url, screen capture
Top Keywords from Search Engines co.cc, dez schubel, mobibookz, margeliz jewelry, paracord nation

Bodysockstore.co.cc Domain Statistics

Title:
www.bodysockstore.co.cc • Buy or Donate on Instagram
SEO score:
36%
Website Worth:
$10,056 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank:
206,368
Primary Traffic:
The country where current domain is most popular relative to the other countries
united states
Alexa backlinks:
109,792
IP-address:
175.126.123.219 [Trace] [Reverse]
Date Registered
2010-08-27 04:00:00
Expires
2012-08-27 04:00:00
Site Age
8 years and 9 months
Email
Owner
c/o GOODRESULTONLINE.COM
Pageviews per User:
1.2
Average Time on Site:
00:31
Search Percent:
Estimated percentage of visits to bodysockstore.co.cc that came from a search engine
7.3%
Bounce:
Estimated percentage of visits to bodysockstore.co.cc that consist of a single pageview
78.1%
Daily Pageviews:
n\a
Contact information:
try to find contact info in whois information
Load Time:
10.62 seconds
advertising

Bodysockstore.co.cc Domain Info

Domain Name: bodysockstore.co.cc
Registrar: DOMAIN
Domain Age: 8 years and 9 months
See bodysockstore.co.cc whois information

Web Safety

bodysockstore.co.cc is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Bodysockstore.co.cc is ranked 206,368th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 206,368 visit alexa Alexa backlinks: 109,792
This report show rough estimate of bodysockstore.co.cc's popularity
The top queries driving traffic to bodysockstore.co.cc from search engines.
dez schubel
co.cc
mobibookz
margeliz jewelry
paracord nation

Bodysockstore.co.cc Visitors Localization

Traffic Estimations Medium
Traffic Rank 206,368th most visited website in the World
united states 32.1 indonesia 16.9
brazil 10.4

Website categories

Currently, we found 8 categories on bodysockstore.co.cc
short links 656 sites tinyurl 697 sites
bitly 8'652 sites bit.ly 807 sites
earn money 5'979 sites link advertising 315 sites
Show more

Bodysockstore.co.cc competitors

Favicon  

Earnspace.co.cc | What do You Think About Earnspace?

Online money earning easy way

| | earnspace.co.cc

Favicon  

Www.earnmoneyathome.co.cc • Buy or Donate on Instagram

Online business ideas and work at home income opportunities.earn money at home delivers legitimateonline

| | earnmoneyathome.co.cc

Favicon  

(www.headphonez.co.cc) on Instagram

Proven ways to make money online securely, fast & better, make massive income

| | incomemania.co.cc

advertising
Favicon  

(www.theirvideo.co.cc) on Instagram

Url redirection service (also known as url forwarding).register a free subdomain name and redirectit

| | vip-url.co.cc

Favicon  

Amirul Alias (www.amirulalias.co.cc) on Instagram

All about myself, blogging tips, how to make money online & other assorted randomness

| | amirulalias.co.cc

Bodysockstore.co.cc Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Favicon  

Www.bodysolidseries7smithgympackagew400lbweightsetgs348qp4osr400s.co...

Lowest prices on body solid series 7 smith gym package w/ 400 lb weight set gs348qp4. Osr400s prices save $ up to 50% off!

| | bodysolidseries7smithgympackagew400lbweightsetgs348qp4osr400s.co.cc

Favicon  

Www.bodysolid11 - Gaugepropowerrackmodelgpr378.co.cc • Buy or Donate On...

60% off body solid 11-gauge pro power rack model gpr378 at best buy

| | bodysolid11-gaugepropowerrackmodelgpr378.co.cc

Favicon  

Www.bodysolidexm4000striplestackhomegym.co.cc • Buy or Donate On...

A huge selection of body solid exm4000s triple stack home gym on sale this week

| | bodysolidexm4000striplestackhomegym.co.cc

Favicon  

Www.bodysolidsbl460p4freeweightleveragegympackage.co.cc • Buy or Donate...

Get the best value for body solid sbl460p4 freeweight leverage gym package its fast. Easy & safe

| | bodysolidsbl460p4freeweightleveragegympackage.co.cc

Favicon  

Buy Bodysocks | Our Fancy Dress Costumes Are Ideal For a Party...

Our costumes are perfect for a party, stag or hen event. We stock a variety of fancy dress outfits including spandex suits and inflatable bodysuits

| | bodysocks.co.uk

Favicon  

Body-society

Shop powered by prestashop

| | bodysociety.de

Favicon  

Cash Advance | Debt Consolidation | Insurance | Free Credit Report...

Find cash advance, debt consolidation and more at bodysock.org. Get the best of insurance or free credit report, browse our section on cell phones or learn about life insurance. Bodysock.org is the site for cash advance

| | bodysock.org

Favicon  

Bodysociety.com

We have bodysociety.com domain for sale. Follow the link and make an enquiry, contact us on +2721 521 4500 or visit http://offer.jimmy.com/ for more domains

| | bodysociety.com

Favicon  

Www.bodysocietylab.com

| | bodysocietylab.com

Bodysockstore.co.cc Websites hosted on same IP

Favicon  

Sbscnbc컨닝

| | astock.biz

Bodysockstore.co.cc Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-06-18, website load time was 10.62. The highest load time is 23.58, the lowest load time is 9.34, the average load time is 17.44.

Whois Lookup For bodysockstore.co.cc

0reviews

Add review