More tools
  • Whois Record
  • Reverse IP
  • Trace IP
  • Whois IP
  • What is my IP
  • Page Rank checker
  • Ping
  • Traceroute
  • Top Up Websites
  • Top Down Websites
Whois Record Trace IP
compare
Get a widget

Parkwaychristianacademy.org

A nationally-accredited Christian school, Parkway Christian Academy equips kids for college, career, and Christ.
advertising
Links Website >>
Website Topics financial aid, education + 2 more>>
Top Keywords from Search Engines parkway, pca + 3 more>>
Parkwaychristianacademy.org is ranked 5,819,906th in the world (amongst the 30 million domains). This site is estimated to be worth $1813. It has 2 backlinks. Parkwaychristianacademy.org has 23% seo score.
Popularity: Safety: Social signals: Legit: legal

Similar websites

Favicon of canyonville.net  

Canyonville.net

Christian Boarding School | College Prep Courses

An affordable christian boarding school that offers grades 9th - 12th quality college prep courses

Popularity: | Safety: | canyonville.net tags for canyonville.net school / school life / boarding school

Favicon of wildwoodchristianacademy.com  

Wildwoodchristianacademy.com

Wildwood Christian Academy | North Georgia Private School | k - 12

Wildwood christian academy is a dually accredited independent school serving pre - k through high school

Popularity: | Safety: | wildwoodchristianacademy.com tags for wildwoodchristianacademy.com private school / christian school / school arts

Favicon of windsorca.org  

Windsorca.org

Windsor Christian Academy – Classical Christian Education in Upper Uwchlan...

Classical christian education in upper uwchlan, pa

Popularity: | Safety: | windsorca.org tags for windsorca.org private christian school / christian school

advertising
Favicon of elcaonline.org  

Elcaonline.org

Eagle's Landing Christian Academy Empowering Students to Impact The...

The largest private, christian school south of atlanta offering kingdom education through outstanding academics

Popularity: | Safety: | elcaonline.org tags for elcaonline.org school / high school / christian

Favicon of rccacademy.org  

Rccacademy.org

Ross County Christian Academy | Chillicothe, Ohio

Popularity: | Safety: | rccacademy.org tags for rccacademy.org christian private school / school / christian

Favicon of roanokecountyschools.org  

Roanokecountyschools.org

Roanoke County Public Schools

Welcome to roanoke county public schools! we are located in the blue ridge mountains of virginia and

Popularity: | Safety: | roanokecountyschools.org tags for roanokecountyschools.org school board / education / roanoke county

Favicon of rrca-tx.org  

Rrca-tx.org

Welcome to Round Rock Christian - Round Rock Christian Academy

Round rock christian academy is a christ - centered, college preparatory school equipping and developing

Popularity: | Safety: | rrca-tx.org tags for rrca-tx.org school / private education / christian

Favicon of oakdaleacademy.com  

Oakdaleacademy.com

Oakdale Academy - a Classical Christian School Based on The Hillsdaleacademy Model...

A classical christian school based on the hillsdale academy model

Popularity: | Safety: | oakdaleacademy.com tags for oakdaleacademy.com christian school / classical school

Favicon of rcaflames.com  

Rcaflames.com

Resurrection Christian Academy

Rca is a private christian school in guelph, ontario that provides dynamic christ

Popularity: | Safety: | rcaflames.com tags for rcaflames.com school / private schools

Favicon of mtparanschool.com  

Mtparanschool.com

Private Christian School in Cobb County | Mount Paran Christian School...

Private christian school in cobb county - come see what makes mount paran one of the best private christian schools (pk

Popularity: | Safety: | mtparanschool.com tags for mtparanschool.com private christian school

Web Safety

parkwaychristianacademy.org is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

General Statistics

Title: Parkway Christian Academy: Best Private Schools in Roanoke
Description: A nationally-accredited Christian school, Parkway Christian Academy equips kids for college, career, and Christ.
SEO score: 23%
Website Worth: $1,813 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 5,819,906
Alexa backlinks: 7
Webstatsdomain backlinks:
IP-address: 192.195.77.29
Daily Pageviews: n\a
Load Time: 0.88 seconds

Website categories

Currently, we found 6 categories on parkwaychristianacademy.org
financial aid 7'586 sites education 215'355 sites
academics 20'145 sites students 118'739 sites
baseball 42'556 sites mission 41'577 sites

Sites with a similar domain name

We found 8 websites. With this list, you can understand how other people are using the domain, similar to yours.

Favicon of parkwaychristian.org  

Parkwaychristian.org

Parkway Christian School

Parkway christian school is a private school that serves christian families ,with children in preschool through the 12th grade. More than 85 churches in ,wayne, oakland, and macomb counties are represented in the student body. ,our school population is di

Popularity: | Safety: | parkwaychristian.org tags for parkwaychristian.org parkway christian school / school / website / classroom websites / students / families / parkway / arts / pcs

Favicon of www.parkwaychristianacademywildcats.com  

Parkwaychristianacademywildcats.com

Parkway Christian Academy Wildcats - Parkwaychristianacademywildcats...

Parkway christian academy wildcats - parkwaychristianacademywildcats.com

Popularity: | Safety: | www.parkwaychristianacademywildcats.com tags for www.parkwaychristianacademywildcats.com parkway christian academy / christian / webmail email / organization / application / cellphone

Favicon of parkwaychristianchurch.org  

Parkwaychristianchurch.org

Parkwaychristian

Parkway christian church and schools 1200 s. Flamingo drive davie, fl so, if you’re looking for a place where you can not only develop a closer relationship with god, but can also become part of a larger ministry beyond yourself, then i think you&r

Popularity: | Safety: | parkwaychristianchurch.org tags for parkwaychristianchurch.org parkway / christian / preschool / pre-school / christian elementary / ministry

Favicon of parkwaychristianpreschool.net  

Parkwaychristianpreschool.net

Parkway Christian Preschool

Parkway christian preschool has been providing quality care in a loving environment for over 50 years

Popularity: | Safety: | parkwaychristianpreschool.net tags for parkwaychristianpreschool.net parkway / christian / preschool / pre-school / davie / florida

Favicon of parkwaychristianschool.net  

Parkwaychristianschool.net

Parkwaychristianschool.net

Parkwaychristianschool.net

Popularity: | Safety: | parkwaychristianschool.net tags for parkwaychristianschool.net school / music

Favicon of parkwaychristian.com  

Parkwaychristian.com

Parkwaychristian.com is Available at Domainmarket.com

Join thousands of profitable companies that generate business through a premium domain that is easy to remember and helps with your search rankings

Popularity: | Safety: | parkwaychristian.com

Favicon of parkwaychristianschool.com  

Parkwaychristianschool.com

Hugedomains.com - Shop For Over 300,000 Premium Domains

Popularity: | Safety: | parkwaychristianschool.com tags for parkwaychristianschool.com domain

Favicon of parkwaychristianschool.org  

Parkwaychristianschool.org

Parkwaychristianschool.org : The Leading Parkway Christian School Siteon...

Popularity: | Safety: | parkwaychristianschool.org

Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
currency exchange roanoke va
12 2016-01-14
stewartsville va library
26 2016-01-04

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Parkwaychristianacademy.org is ranked 5,819,906th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 5,819,906 visit alexa Alexa backlinks: 7
This report show rough estimate of parkwaychristianacademy.org's popularity
The top queries driving traffic to parkwaychristianacademy.org from search engines.
parkway christian academy
pca bookstore
pca summer camp
parkway
pca

Visitors Localization

Traffic Estimations Low
Traffic Rank 5,819,906th most visited website in the World

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.88. The highest load time is 0.88, the lowest load time is 0.45, the average load time is 0.61.

Contact information:

http://parkwaychristianacademy.org/athletics.php - Athletic Program - Parkway Christian Academy
http://parkwaychristianacademy.org/contact.php - Contact Us - Parkway Christian Academy
See parkwaychristianacademy.org contact information in whois record

0reviews

Add review