Portsmouthnaval.com

portsmouthnaval.com: The Leading Portsmouth Naval Site on the Net

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Portsmouthnaval.com Domain Statistics

Title:
portsmouthnaval.com: The Leading Portsmouth Naval Site on the Net
SEO score:
9%
Website Worth:
$189 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
IP-address:
0.0.0.0
Daily Pageviews:
n\a
Contact information:
try to find contact info in whois information
advertising

Portsmouthnaval.com competitors

 

Portsmouth Naval Base Property Trust

| | www.pnbpropertytrust.org

 

Outside Caterers Portsmouth | The Galley Box...

The galley box are outside caterers in the portsmouth naval base.we provide a complete food servicewith

| | thegalleybox.com

 

French Fleet Air Arm - Site Sur L'aéronautique Navale Française...

Unofficial web site dedicated to french naval aviation (aeronavale) - site non - officiel dédié à

| | www.ffaa.net

 

Portsmouth Naval Gliding Centre

Daedalus airfield at lee - on - the - solent (now known as solent airport) is the home of portsmouth navalgliding centre

| | www.pngc.co.uk

 

Portsmouth Dating - Dating For Everyone in Portsmouth

Portsmouth dating - search for singles in your local area.online dating in portsmouth featuring

| | www.portsmouth-dating.co.uk

 

Web Design Portsmouth | Courtney Website Design Company Portsmouth Hampshire...

Web design portsmouth hampshire.discover how our unique, affordable website design can benefit you

| | www.courtneyuk.com

 

Fabrication Site Services Ltd in Portsmouth

Fabrication site services ltd in portsmouth, southampton, chichester, winchester, worthing

| | fabricationsiteservices.com

 

Portsmouth Team Building Company - Official Site (nh, ma & Me)...

New england's premier team building company! fun and exciting outdoor and indoor corporate

| | www.portsmouthteambuilding.com

 

Meiggs Realty (we Know Real Estate) Best va Realtor Top Agents...

The best realtor, real estate agents and property management company in virginia to help you buy

| | www.meiggs.com

Portsmouthnaval.com Sites with a similar domain name

We found 17 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Portsmouthnh.com | Guide to Portsmouth nh And Seacoast

Comprehensive information about portsmouth nh and the seacoast for travelers and residents. Things to do, calendar, restaurants, lodging, photos and more

| | portsmouthnh.com

 

Portsmouth Garden Club

Portsmouth garden club portsmouth nh new hampshire festival of trees 2009 grants scholarships brochure

| | portsmouthnhgardenclub.com

 

Portsmouth Night Out - Portsmouth va Nightlife, Events, Restaurants...

Portsmouthnightout.com promotes events, specials and fun things to do in the portsmouth va area. Find restaurants, dining, bars, pubs, clubs, live music, bands, dancing, entertainment, lodging, and more

| | portsmouthnightout.com

 

Cumberland House Natural History Museum

Cumberland house portsmouth natural history museum and

| | portsmouthnaturalhistory.co.uk

 

Portsmouth (va) First Church of The Nazarene

Portsmouth (va) first church of the nazarene is located at 2512 barclay ave in portsmouth, va. We have ministries for all ages including children, youth, and adults. All are welcome to join us as we strive to know, love, and serve jesus christ

| | portsmouthnazarene.org

 

Home Page

| | portsmouthnappies.co.uk

 

Sorry

The portsea island decorative and fine arts society is affiliated to nadfas

| | portsmouthnadfas.co.uk

 

Portsmouthnaildesigns.co.uk

| | portsmouthnaildesigns.co.uk

 

Naval Medical Center Portsmouth, va Housing And Relocation Information...

Naval medical center portsmouth housing. Housing relocation information & real estate resources for naval medical center portsmouth, va

| | portsmouthnavalmedicalcenterhousing.com

 

Find Jobs. Quicker, Better, Smarter.

Portsmouthnavalshipyard.jobs is your source for portsmouthnavalshipyard career opportunities. Search millions of real-time portsmouthnavalshipyard job openings and read portsmouthnavalshipyard career/recruiting advice from industry experts. Portsmouthnava

| | portsmouthnavalshipyard.jobs

 

Portsmouthnavelshipyard.com | The Best Place to Find Portsmouth...

The best place to find portsmouth naval shipyard

| | portsmouthnavelshipyard.com

 

Balfour Beatty Communities

| | portsmouthnavalshipyardmilitaryfamilyhousing.com

 

Portsmouthnavalshipyard.com

Portsmouthnavalshipyard.com

| | portsmouthnavalshipyard.com

 

Portsmouthnavalhospital.com

| | portsmouthnavalhospital.com

 

Portsmouthnavalhomes.com

Portsmouthnavalhomes.com

| | portsmouthnavalhomes.com

 

Portsmouth Navy Yacht Club

The official site of the portsmouth navy yacht club, located in portsmouth, n.h

| | portsmouthnavyyachtclub.com

Web Safety

portsmouthnaval.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Portsmouthnaval.com Visitors Localization

Traffic Estimations Low
Traffic Rank No data available for this site. most visited website in the World

Whois Lookup For portsmouthnaval.com

0reviews

Add review