Spellspot.com
Wiccan Supplies - SpellSpot has Wicca supplies for every path at affordable prices. Huge Witchcraft Supplies Store selling Wiccan Jewelry, Stones, Herbs, Candles, Pagan Jewelry and Music
Spellspot.com Domain Statistics
Spellspot.com competitors
Pagan Store, Wiccan Store, Witchcraft Store, an Online Pagan...
Pagan store, wiccan store, witchcraft store - pagan store, wiccan store, witchcraft store, pagan products
| | bellirosa.com
Witchcraft Shop - Wiccan, Pagan And Magick | Witchcraft Shop - Wiccan...
Shop for candle magick, wands, incense, ritual supplies, witchcraft jewellery, ouija boards and other
| | witchcraftshop.net
Wicca Supplies, Pagan Supplies, Witchcraft Supplies, Spiritual Supplies...
| | wiccasupplies.ca
Wiccan Supplies, Witchcraft Supplies, Wiccan Store | Sacredmists.com
Explore wicca supplies and witchcraft supplies for the metaphysical pagan.sacred mists
| | sacredmists.com
Wicca Supplies, Pagan Supplies, Witchcraft Supplies And Spiritual Supplies...
| | newawakening.ca
Ancient Light, Wiccan Supplies, Witchcraft Supplies, Metaphysical Gifts...
Ancient light pagan and wiccan gifts and handicrafts store in waldport, oregon : embroidery, toys
| | ancientlight.info
Wholesale Wiccan Supplies & Witchcraft Supplies, Wiccan Supplier
Wiccan supplier is a wholesale wiccan store for other wiccan supplies stores.40% off retail price on all products
| | wiccansupplier.com
Mystickal Arts Treasures - Buy Pagan, Wiccan & Witchcraft Supplies...
Specializing in pagan supply, wicca, witchcraft and occult supplies.we carry a huge selection of books
| | mystickalartstreasures.com
, Wiccan, Pagan, Witchcraft, Ritual Supplies, The Ritual Chest
Suppliers of wiccan, pagan, witchcraft, and ritual products., from unusual ingredients for hoodoo
| | ritualchest.com
Wicca Spells, Pagan Religion, Wiccan Symbols, Athame Shop :.shop Online...
Low prices ; exquisite quality! we offer discounts on practically everything! peruse our spiritual
| | athames.com
Wicca, Wiccan Witchcraft Spells & Rituals, Paganism
Learn about wicca, witchcraft, paganism, magick, spells & rituals, occult.online source of wicca
| | thewiccaway.com
Wicca, Witch, Pagan, Witchcraft, Druid, New Age Shop...
Uk shop for esoteric items for witches, wiccans, pagans, shamans, gothic, crystal healers, angel workers
| | motherofthemoon.co.uk
Pagan/wiccan/witchcraft Products & Supplies - Silver Jewelry - Cauldrons...
Shop now! pagan/wiccan/witchcraft products & supplies - ravens attic offers a huge line of spiritual
| | ravensattic.com
Magickal, Ceremonial, Spiritual, Ritual, Witchcraft, Occult And Wiccan...
Ravenhawks magickal mystical places is your online store for witchcraft supplies, wiccan supplies
| | ravenhawksmagickalmysticalplaces.com
Moonlight Mysteries Wholesale Pagan Wiccan Statues Supplies And Jewelry...
High quality wholesale products for wiccans and pagans, featuring the work of dryad design
| | moonlightmysteriesws.com
The Blessed Bee
Theblessedbee.com, your trusted online source for pagan wiccan witchcraft new age occult supply store
| | theblessedbee.com
Wicca, Pagan And Occult Practice Mega Store
Metaphysical online store : the tarot oracle is your source for wiccan, pagan, occult
| | thetarotoracle.com
保湿クリームを敏感肌に使う時に気をつけたい事
We are a privately owned store whose purpose is to not only assist the new witch or wizard in finding
| | shadowsoftheshades.com
The Good Wiccan – Your Complete Resource For The Beginner Solo Solitary...
Welcome! the good wiccantm complete resource guide for the beginner solo practitioner is a leaping
| | goodwiccan.com
Wiccan Supplies|witch Shop|pagan|thegypsyhaven.com|illinois
We are elgin, il's only witch shop and wiccan supplies store! 143 w river rd, elgin, il www.thegypsyhaven
| | thegypsyhaven.com
Spellspot.com Sites with a similar domain name
We found 18 websites. With this list, you can understand how other people are using the domain, similar to yours.
Spell Sports - Personalised Bespoke Sports Clothing And Equipment Embroidered And Printed...
Spell sports is your home for all custom personalised sports clothing and equipment with embroidery and print. We cover cricket, rugby, football and many other sports with individual items and full team kits. We can also set up your own club shop, buy thr
| | spellsports.co.uk
Spells And Magic : Spells, White Magic, Black Magic, Hexes, Curses Talismans...
Magic spells like white magic spells, black magic spells, curses, hexes, talismans, charms, magic spells for love, money, black magic, white magic hex and curse available
| | spellspower.com
Spellspace, Tarot For Living
Free tarot readings for living. Seek insight help from others about your tarot readings, then recommendations from our store
| | spellspace.com
Paranormal Hub
| | spellspotionsplus.com
Spellspend.com at Directnic
| | spellspend.com
Spell Spinners 'spell And Potion For Weary Worrywarts'...
Empower your realm of spiritual well-being with the magic of incense, herbs, powders, crystals, mystical jewellery, oils, spells and much more. Specialists in rare botanicals, incense and magical supplies since 1989
| | spellspinners.com
Hugedomains.com - Spellspring.com is For Sale (spell Spring)
| | spellspring.com
Spellspin.com – このドメインはお名前.comで取得されています。
| | spellspin.com
Domain Expired
| | spellspin.co
Carlife Jack | Car Life Speciall Site
| | spellsphilly.net
Spellspecialist.info
| | spellspecialist.info
Spellspedia.com
| | spellspedia.com
Spells Zone
| | spellspt.com
Spells
What defines spells .well we at spells provide you with with up to date information you need to know about spells that you don't have to go any anywhere else
| | spellsplace.com
Dfyne Sports & Designerwear
Dfyne sports & designerwear
| | spellsports.com
Spellsport
Spellsport.com offers the most relevant information on spellsport and more
| | spellsport.com
Spellspook.com
Welcome to spellspook.com
| | spellspook.com
my Computer
Im spell, i make beats and stuff. This is my website. Have a look around! feel free to listen to some of my music, or download a mixtape. I also have some mean as videos yous can watch to. Shot
| | spellspellspell.com
Spellspot.com Domain Info
Domain Name: | spellspot.com |
Registrar: | GoDaddy.com, LLC |
Domain Age: | 20 years and 8 months |
See spellspot.com whois information |
Web Safety
spellspot.com is
website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.Is Spellspot.com Legal or Not
URLs Requested to be Removed: | 0 |
---|---|
Urls removed: | 0 |
Percent: | 0% |
Summary: | Spellspot.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Spellspot.com Visitors Localization
Traffic Estimations | |
---|---|
Traffic Rank | 9,826,435th most visited website in the World |
Website categories
wiccan supplies 100 sites | wicca supplies 50 sites |
wiccan jewelry 27 sites | witchcraft supplies 90 sites |
pagan supplies 78 sites | wicca 3'447 sites |
Spellspot.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
Keyword | Position | Date |
---|---|---|
return to nature spell | 11 | 2016-02-12 |
witchcraft spell | 13 | 2016-02-14 |
magical properties of carnelian | 16 | 2016-01-17 |
wicca store | 17 | 2016-02-02 |
cheap witch craft supplies | 18 | 2015-12-21 |
carnelian magical properties | 20 | 2016-01-17 |
pagan jewelry | 22 | 2015-12-09 |
wiccan stores | 22 | 2015-12-08 |
wiccan supplies stores | 22 | 2015-11-22 |
wiccan spells free | 22 | 2015-11-11 |
Spellspot.com Websites hosted on same IP
Anj News
Interesting article directory on various topics
| | www.anjnews.com
Vacation Rentals by Owner, Vacation Homes Rental, Beach House Rentals
Vacation rentals by owner site for vacation beach houses, cabins, condos, vacation homes rental, villas rentals, yachts rentals, home away and holiday rentals
| | www.zoomtrans.com
The Moms Buzz - Lifestyle Tips For Busy Moms
The moms buzz lifestyle tips for busy moms is a blog dedicated to busy moms. As busy moms in a modern world, we want a helping hand to help us deal with daily challenges at home, work and life in general. The moms buzz lifestyle tips for busy moms will do
| | themomsbuzz.com
Iron Coding | Nothing to See Here
| | www.ironcoding.com
Raw Shorts, a Cloud Based Video Builder Inspiration
Find the best apps for android, iphone and ipad with our app recommendation & discovery tools. Download free apks today!
| | www.rawapps.com
Arizona's Top Rated Resume Service - Perfect Resumé - an Award...
Ranked #1 in arizona | ,featured on abc, nbc, cbs, yahoo.com, and monster.com | ranked #1 on yelp in arizona
| | www.perfectresumeaz.com
Boatiing on The Tennessee And Cumberland Rivers
| | www.tnriver.com
Home | Friendship Home | Safe Shelter And so Much More | Lincoln, Nebraska...
Welcome to friendship home it is friendship homes vision that someday the need for our services will cease to exist, that domestic violence will not be tolerated by anyone in the community and that homes will be places of love, support and safety. We envi
| | www.friendshiphome.org
Dougconn.com Sleight of Hand Magic
Doug conn, new orleans professional magician. Comedy close-up or stage magic for your party / event
| | www.dougconn.com
Oxstein Labs | Harnessing The Power of Collective Intelligence
| | www.oxsteinlabs.com
Spellspot.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 0.21. The highest load time is 0.55, the lowest load time is 0.19, the average load time is 0.26.