Vancouverfirstaid.ca

We offer Red Cross courses and re-certifications across the Vancouver Lower Mainland. We offer courses in Burnaby, Coquitlam, Delta, Richmond, Surrey and

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Vancouverfirstaid.ca Domain Statistics

Title:
Vancouver First Aid - First Aid, CPR, AED and Safety Courses
Description:
We offer Red Cross courses and re-certifications across the Vancouver Lower Mainland. We offer courses in Burnaby, Coquitlam, Delta, Richmond, Surrey ... more
SEO score:
34%
Website Worth:
$4,751 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank:
1,473,539
Primary Traffic:
The country where current domain is most popular relative to the other countries
canada
Alexa backlinks:
Webstatsdomain backlinks:
IP-address:
Date Registered
2010-09-17 00:00:00
Expires
2021-09-17 00:00:00
Site Age
11 years and 0 months
Pageviews per User:
1.7
Average Time on Site:
02:15
Search Percent:
Estimated percentage of visits to vancouverfirstaid.ca that came from a search engine
50.7%
Bounce:
Estimated percentage of visits to vancouverfirstaid.ca that consist of a single pageview
66.7%
Daily Pageviews:
n\a
Load Time:
2.11 seconds
advertising

Vancouverfirstaid.ca competitors

 

First Aid Safety Training - Edmonton First Aid, Cpr And Safety Courses...

First aid, cpr training, healthcare provider cpr, h2s alive training, ground disturbance course

| | firstaidsafetytraining.ca

 

Frontline Health First Aid Cpr Aed Training in New York, Ny...

We provide first aid cpr aed and bls for healthcare providers training certification classes in newyork city

| | www.frontlinehealth.com

 

American Heart Association Authorized Provider of Cpr, Aed...

Emc cpr & safety training, llc is the premier provider of cpr certification classes and workplace safety training

| | www.emccprtraining.com

 

Online Cpr Certification & Online First Aid Certification ...

Get your cpr certificate, first aid certificate, and aed certificate in the comfort of your home

| | www.cprtoday.com

 

Red Cross First Aid Training & Cpr Training Courses

Red cross certified, wsib approved, first aid and cpr training courses, first aid kits and supplies

| | www.firstaid4u.ca

 

Stac First Aid Training | First Aid Courses, First Aid Limerick...

First aid course limerick, first aid training limerick, first aid class limerick, cpr class limerick

| | www.stacfirstaidcourses.ie

 

Cpr Classes Chicago, Cpr Training, Aed, Cpr Certification Chicago...

Citywidecpr.com provides cpr classes, aed cpr, cpr certification, first aid classes online

| | www.citywidecpr.com

 

Online Cpr Courses, First Aid Training & Certification – Simple Cpr...

Simple cpr selected by the american health association (aha) as the #1 online training center

| | www.simplecpr.com

 

Cpr, Aed Training And re - Certification, Heartsaver First Aid in Melbourne...

Brevard county, florida cpr training services, including, aed, heart savers, on - site cpr training and

| | www.brevardcpr.com

 

First Aid & Cpr Training Courses | Sos First Aid

Red cross wsib - approved certified and recertified first aid & cpr training in brampton, burlington

| | sosfirstaid.ca

Vancouverfirstaid.ca Sites with a similar domain name

We found 16 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Vancouver Fireworks | Vancouvers Blog

The honda celebration of light returns for 2013 with three new competing countries from july 27 to august 3, 2013 in vancouver, bc

| | vancouverfireworks.ca

 

Vancouver Firefighter Charities | Vancouverfirefighters.ca

Vancouver fire fighters have a proud and long-standing history of fundraising in our community. The vancouver fire fighters’ charitable society was officially formed in 1998 to build on our legacy of community work

| | vancouverfirefighters.ca

 

Vancouver Firewood | Firewood For Sale in Vancouver, bc

Vancouver firewood offers firewood for sale to residents of vancouver including free delivery service to vancouver, delta, burnaby and surrounding areas

| | vancouverfirewood.ca

 

Website Disabled

| | vancouverfirsttimebuyers.com

 

oz Buzz Jurock Real Estate Insider

Detailed weekly newsletter on the canadian and american real estate markets. Get ozzie jurock’s real estate insider to find out what it all means!

| | vancouverfirst.com

 

Web Hosting, Domain Name Registration And Web Services by 1...

1&1 offers web hosting, domain names, website builders, servers, and email solutions. Find affordable, dedicated ad-free web hosting, domain name registration and e-mail solutions. choose 1&1 internet to host your small business website or person

| | vancouverfirsttimehomebuyer.com

 

Web Hosting, Domain Name Registration And Web Services by 1...

1&1 offers web hosting, domain names, website builders, servers, and email solutions. Find affordable, dedicated ad-free web hosting, domain name registration and e-mail solutions. choose 1&1 internet to host your small business website or person

| | vancouverfirsttimehomebuyers.com

 

1&1 Hosting

1&1 online success

| | vancouverfirst.org

 

Welcome to Vancouver wa Chimney Repair | Chimney Sweep...

Vancouver’s best fireplace repair, chimney sweep and chimney repair company in wa

| | vancouverfireplaceandchimneyrepair.com

 

Vancouver Fire And Rescue Services...

Vancouver fire and rescue services are the first responders in the event of many emergency and non-emergency incidents, including fires and medical alerts

| | vancouverfiredepartment.com

 

by Any Design Ltd

| | vancouverfireplacerenovations.com

 

Under Construction Vancouverfirerescue.com

Vancouver fire and rescue services are the first responders in the event of many emergency and non-emergency incidents, including fires and medical alerts

| | vancouverfirerescue.com

Vancouverfirstaid.ca Domain Info

Domain Name: vancouverfirstaid.ca
Registrar: whois.ca.fury.ca
Domain Age: 11 years
Time Left: 0 days
See vancouverfirstaid.ca whois information

Vancouverfirstaid.ca Contact information :

http://vancouverfirstaid.ca/about/ - About us -
http://vancouverfirstaid.ca/about/contact-us/ - Contact us
Facebook profile for vancouverfirstaid.ca - Vancouver First Aid Ltd. | Facebook
https://plus.google.com/109904557613437016400 - Vancouver First Aid Ltd. - Google+
@vanfirstaid - Vancouver First Aid (@Vanfirstaid) | Твиттер
See vancouverfirstaid.ca contact information in whois record

Web Safety

vancouverfirstaid.ca is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Vancouverfirstaid.ca is ranked 1,473,539th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 1,473,539 visit alexa Alexa backlinks: 58
This report show rough estimate of vancouverfirstaid.ca's popularity
The top queries driving traffic to vancouverfirstaid.ca from search engines.
first aid course
first aid course vancouver
vancouver first aid
how long does cpr certification last
cpr stands for

Vancouverfirstaid.ca Visitors Localization

Traffic Estimations Low
Traffic Rank 1,473,539th most visited website in the World
canada 83.3

Website categories

Currently, we found 8 categories on vancouverfirstaid.ca
first aid courses 502 sites first aid training 1'507 sites
first 17'382 sites first aid and cpr 55 sites
aid and cpr 25 sites standards 16'252 sites
Show more

Vancouverfirstaid.ca Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
red cross vancouver cpr classes
2 2015-12-10
emergency first aid course
3 2016-02-13
food safe lvl 1
5 2015-11-18
dander allergy medication
9 2015-12-14
course registration system
10 2015-12-07
pectin allergy
12 2016-01-17
supraspinatus tendon
13 2015-12-13
level 1 first aid.
15 2016-02-04
splinters and rags
16 2015-12-12
supraspinatus tendon tear
17 2015-12-13

Vancouverfirstaid.ca Websites hosted on same IP

 

Mini Laptop India Specifications Price And Review

Find reviews, price lists and specifications of latest and old mini laptops in india and usa

| | minilaptopindia.com

 

December Survey

Скачать программы бесплатно можно на нашем портале. Скачать бесплатно можно и варез

| | www.wizar.org

 

Home - John Mcduffie

Set writing goals now. Ill help. We are all different and what works for one of us may not work for all of us, but lets try some things and see what works

| | www.john-mcduffie.com

 

Precision Edge Design

Precision edge design is a website design and graphic design company located in palm harbor, fl. We offer search engine optimization (seo), logo design, e-commerce website design, flash design, and custom graphic design at an affordable price

| | www.precisionedgedesign.com

 

Apple Ipad Blog. Ipad News, Cases, Reviews, Rumors, Updates

The best apple ipad news blog that promises to keep you updated about everything related to ipad

| | ipaded.net

 

Windowsphonereview.com Windows Phone Review, News...

This site is all about windows phone news, reviews, rants and raves. No-nonsense windows phone news, reviews

| | windowsphonereview.com

 

Alllaptopreview.com

| | www.alllaptopreview.com

 

Action For Animals Austin - Speaking up For Those Who Cant.

Speaking up for those who cant

| | www.actionforanimalsaustin.org

Vancouverfirstaid.ca Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 2.11. The highest load time is 2.11, the lowest load time is 1.68, the average load time is 1.89.

Whois Lookup For vancouverfirstaid.ca

0reviews

Add review