1worldmedicine.com

1 World Medicine provides Family doctors in Las Vegas, Primary Care, Urgent Care and Occupational Medicine. Our services include Chiropractic, Acupuncture, Kinesiology, Ayurvedic (East Indian), Chinese Medicine, Nutrition, Massage, Yoga as well as traditi

Popularity: Safety: Legit: legal Contact info: Contact page labriesrjj@aol.com
advertising

1worldmedicine.com Domain Statistics

Title:
Default Web Site Page
Description:
1 World Medicine provides Family doctors in Las Vegas, Primary Care, Urgent Care and Occupational Medicine. Our services include Chiropractic, Acupunc... more
Top Keywords from Search Engines:
SEO score:
24%
Website Worth:
$1,839 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
IP-address:
Date Registered
2010-01-27 05:00:00
Expires
2015-01-27 05:00:00
Site Age
14 years and 2 months
Email
Owner
James LaBrie
Daily Pageviews:
n\a
Contact information:
try to find contact info in whois information
Load Time:
0.36 seconds
advertising

1worldmedicine.com competitors

 

Urgent Care And Walk-in Clinic Davie, fl | Quick Family Urgent Care

Urgent care, walk-in clinic, doctor, davie, fl, family health care, children, adults, physical exam

| | quickurgentcare.com

 

Caryfamilypracticeandwalkinclinic.com

We are accepting new patients  we accept most insurance plans aetna bluecross blueshield of

| | caryfamilypracticeandwalkinclinic.com

 

One Healthcare Centre | Remedial Services

One healthcare manifests the power of unity.a revolutionary design offers clients a one stop shop

| | onehealthcarecentre.com

 

Urgent Care & Walk-in Clinic Near Troy, mi | Somerset Urgent Care

Somerset urgent care is a cost effective alternative to visiting the emergency room.we treat non life

| | somerseturgentcare.com

 

Urgent Care Near me Spokane wa | Franklin Park Urgent Care

Urgent care near me spokane wa open 7 days call (509) 792 - 3474 walk - ins welcome no appointment needed

| | fpucc.com

 

Urgent Care + Primary Care | Applecare Clinics

Applecare urgent care + primary care operates 13 locations across south georgia

| | applecaredoctors.com

 

Family Health Care

Keeping families healthy

| | afaho.org

 

Uni Urgent Care Walk In. Get The Best Treatment. Feel Better!

Responsive medical health wordpress theme

| | uniurgentcare.com

 

Indianapolisfamilymedicine.com

See this go daddy instantpage! http : //indianapolisfamilymedicine.com.get yours free with a domain name at godaddy

| | indianapolisfamilymedicine.com

 

Urgent Care Near Imperial Beach, ca | Walk - in Clinic...

Urgent care & walk - in clinic for adults and children near imperial beach, ca.open early & late 7 days a week

| | coronadobayurgentcare.com

 

Family Practice Center | Central Pennsylvania Family Doctor...

Our doctors have appointments available 7 days a week including early morning and evenings

| | fpcdoctors.com

 

Afterours Urgent Care Right Care Right Now!

An afterours urgent care walk in clinic visit averages less than half the cost and wait of an er

| | afteroursinc.com

 

Urgent Care, Family Practice, Walk - in Clinic, Doctors in Kansas City...

Kansas city doctors for urgent care, walk - in clinic, family health care, internal medicine

| | sunflowermed.com

 

Quick Care Med | Walk - in Clinic & Urgent Carequick Care Med | Walk...

Quick care med, quick care, citrus county, urgent care, walk in, walk - in, ocala urgent care, ocala walk

| | quickcaremed.com

 

Walk-in Same Day Urgent Care Houston, tx 77068 - Family Physician

Sim family clinic in houston, tx offers quality healthcare for infants, children, teens, adults andseniors

| | simmd.com

 

Saint Mary's Health System - Saint Mary's Hospital in Waterbury...

Saint mary’s hospital in waterbury, ct, is an award - winning, not - for - profit

| | stmh.org

 

Home

Primecare is the one - stop solution for the health care needs of you, your family and your business/organization

| | primecaredothan.com

 

Paso Robles ca Urgent Care Clinic | 93446 | Medpost

If you need immediate medical attention in paso robles, ca, turn to medpost urgent care to quickly

| | twincitiesurgentcare.com

 

Urgent Care Farmington Hills, mi | Urgent Care Near me

Urgent care & walk - in clinic for adults and children near farmington hills.open early & late 7 daysa week

| | rclinic.net

1worldmedicine.com Sites with a similar domain name

We found 16 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Servicio Desactivado

| | 1worldmanagement.com

 

1worldmedium

1worldmedium

| | 1worldmedium.com

 

1worldmedia.net

Promotional products business gifts online catalog of over 900,000 products & ideas including all brandname cross, parker, waterman, sheaffer, swiss army knives and watches gifts adspecialty products and a whole lot more

| | 1worldmedia.net

 

Home

Bluehost - top rated web hosting provider - free 1 click installs for blogs, shopping carts, and more. Get a free domain name, real non-outsourced 24/7 support, and superior speed. Web hosting provider php hosting cheap web hosting, web hosting, domain na

| | 1worldmediagroup.com

 

Site Temporarily Unavailable

Octv.com

| | 1worldmedianetwork.com

 

1worldmeetup.com

| | 1worldmeetup.com

 

1worldmeetup.net

| | 1worldmeetup.net

 

Registered at Namecheap.com

| | 1worldmontessori.com

 

Home

1 world migration consultants

| | 1worldmigrationconsultants.com

 

1worldministry.info

| | 1worldministry.info

 

1worldministry.net

| | 1worldministry.net

 

1worldministry.com

| | 1worldministry.com

 

Contact Support

1worldmuzik.com is dedicated to give aspiring artists a chance to get there music heard. Here you can perform, market, and debut your own music. Hip hop, r&b, rock

| | 1worldmuzik.com

 

1worldmagazine.com

| | 1worldmagazine.com

 

1worldmagazine.net

| | 1worldmagazine.net

1worldmedicine.com Domain Info

Domain Name: 1worldmedicine.com
Registrar: GoDaddy.com, LLC (http://www.godaddy.com)
Domain Age: 14 years and 2 months
See 1worldmedicine.com whois information

Web Safety

1worldmedicine.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

1worldmedicine.com Visitors Localization

Traffic Estimations Low
Traffic Rank 6,036,530th most visited website in the World

Website categories

Currently, we found 14 categories on 1worldmedicine.com
urgent care las vegas 22 sites quick care 30 sites
walk in clinic 301 sites medicine 61'180 sites
las vegas doctors 12 sites primary care 2'748 sites
Show more

1worldmedicine.com Websites hosted on same IP

 

Home - Preferred Rental Services

Santa barbara rentals, find rentals, houses, homes, townhomes, townhouses, condos, condominiums, duplexes, studios, guesthouses, vacation sublets and apartments for rent, preferred rental is a rental listing and relocation service in santa barbara, santa

| | www.preferredrental.com

 

Alaskan Tough Yurts | Nomad Shelter Yurts | Quality Alaskan Yurts...

Based in homer alaska, nomad shelter manufactures and sells yurts worldwide

| | www.nomadshelter.com

 

404 Not Found

Based in new orleans and homer, alaska with clients throughout the united states, blinktank studios provides website design, website development web hosting and videography, from concept to completion

| | www.bemelsa.org

 

Architect - Austin Texas

Architect services by derek barcinski austin, texas - commercial, residential and interior design, remodeling and renovation

| | www.atlantisarchitects.com

 

Homer Water Taxi | Kachemak Bay | Homer Alaska - Ie8

Providing water taxi and freight services to the homer and kachemak bay communities

| | www.homerwatertaxi.com

 

Home | High Sierra Energy

The high sierra energy foundation is a nonprofit corporation supported by local individuals, businesses and local government agencies, including the town of mammoth lakes and mono county. The mission of the foundation is to promote and develop energy effi

| | www.highsierraenergy.org

 

風俗遊びの上級者

Based in new orleans and homer, alaska with clients throughout the united states, blinktank studios provides website design, website development web hosting and videography, from concept to completion

| | www.bodiehouse.com

 

Puffin Electric, Inc. | Puffin Electric

Puffin electric, inc. Focuses on commercial and industrial public works projects throughout alaska with a recent emphasis, over the past several years, of marine electrical installations

| | www.puffinelectric.com

 

Vertitas Educational Foundation - Home

The veritas educational foundation is a judeo christian non-profit educational foundation based out of austin, texas

| | veritaseducationalfoundation.org

1worldmedicine.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.36. The highest load time is 0.47, the lowest load time is 0.11, the average load time is 0.23.

Whois Lookup For 1worldmedicine.com

0reviews

Add review