More tools
  • Whois Record
  • Reverse IP
  • Trace IP
  • Whois IP
  • What is my IP
  • Page Rank checker
  • Ping
  • Traceroute
  • Top Up Websites
  • Top Down Websites
Whois Record Trace IP
compare
Get a widget

Fisherpaykel.co.nz

Fisher&Paykeldesignsandmanufacturespremiumaward-winninghomeappliances.BrowseourrangeandfindyournearestretailerinNewZealand.
advertising
Links Website Twitter >>
Website Topics home appliances + 9 more>>
Top Keywords from Search Engines fisher & paykel
Fisherpaykel.co.nz is ranked 124,619th in the world (amongst the 30 million domains). This site is estimated to be worth $12770. It has 17 backlinks. Fisherpaykel.co.nz has 43% seo score.
Popularity: Safety: Social signals: Legit: legal

Similar websites

Favicon of www.fisherpaykel.com  

Fisherpaykel.com

Kitchen & Laundry Appliances - Fisher & Paykel us

Fisher & paykeldesignsandmanufacturespremiumaward - winninghomeappliances.browseourlineupofproductsandfindyournearestusdealer

Popularity: | Safety: | www.fisherpaykel.com tags for www.fisherpaykel.com home appliances / cooking appliance / laundry appliance

Favicon of www.dcsappliances.com  

Dcsappliances.com

Professional Grade Home Appliances For Indoor Kitchens And Outdoor Kitchens...

Manufacturerofcommercialcookingequipment.productsincluderanges, convectionovens, char - broilers, griddles

Popularity: | Safety: | www.dcsappliances.com tags for www.dcsappliances.com home appliances / cooking appliance / laundry appliance

Favicon of www.whirlpool.com  

Whirlpool.com

Home, Kitchen & Laundry Appliances & Products | Whirlpool

Choose whirlpool products and appliances and trust they’ll handle your family’s chores with care

Popularity: | Safety: | www.whirlpool.com tags for www.whirlpool.com home appliances / whirlpool appliances / appliances

advertising
Favicon of www.siemens-home.co.uk  

Siemens-home.co.uk

Welcome to Siemens Home Appliances

Discover our full range of intelligent appliances and find the right siemens model for your home

Popularity: | Safety: | www.siemens-home.co.uk tags for www.siemens-home.co.uk home appliances / appliance / siemens home appliances / appliances

Favicon of www.kitchenaid.com  

Kitchenaid.com

Kitchen Appliances to Bring Culinary Inspiration to Life | Kitchenaid

Discover premium kitchenaid appliances.our countertop appliances and major kitchen appliance suitesare

Popularity: | Safety: | www.kitchenaid.com tags for www.kitchenaid.com home appliances / kitchen appliance / kitchen appliances / appliances

Favicon of www.beko.co.uk  

Beko.co.uk

Freestanding & Built-in Home & Kitchen Appliances | Beko uk

With more than 20 million appliances sold in the uk, bekos reliable, award - winning appliances are

Popularity: | Safety: | www.beko.co.uk tags for www.beko.co.uk appliances / refrigeration / cooking / laundry

Favicon of www.appliancesconnection.com  

Appliancesconnection.com

Home & Kitchen Appliance Stores Sale - Buy Online...

Major brands at affordable prices.find fantastic savings, reviews, and much more at appliances connection

Popularity: | Safety: | www.appliancesconnection.com tags for www.appliancesconnection.com home appliance / appliance / appliance parts

Favicon of www.williams-sonoma.com  

Williams-sonoma.com

Cookware, Cooking Utensils, Kitchen Decor & Gourmet Foods...

Make williams sonoma your source for gourmet foods and professional - quality cookware

Popularity: | Safety: | www.williams-sonoma.com tags for www.williams-sonoma.com kitchen appliances / cooking utensils / home decor / cooking

Favicon of www.appliancepartspros.com  

Appliancepartspros.com

Appliance Parts Pros.com Discount Appliance Parts – Since 1999

Over 2.1 million appliance parts in stock, ship the same day.free tech support.365 days to returnany part

Popularity: | Safety: | www.appliancepartspros.com tags for www.appliancepartspros.com appliance parts / discount appliance parts / appliance repair / appliance repair parts

Web Safety

fisherpaykel.co.nz is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

General Statistics

Title: Kitchen & Laundry Appliances | Fisher & Paykel NZ
Description: Fisher&Paykeldesignsandmanufacturespremiumaward-winninghomeappliances.BrowseourrangeandfindyournearestretailerinNewZealand.
SEO score: 43%
Website Worth: $12,770 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 124,619
Alexa backlinks: 59
Webstatsdomain backlinks:
IP-address: 202.12.105.17 [Trace] [Reverse]
Redirect: www.fisherpaykel.com/nz.html[Analysis]
Daily Pageviews: n\a
Load Time: 2.51 seconds

Website categories

Currently, we found 13 categories on fisherpaykel.co.nz
home appliances 2'405 sites cooking appliance 34 sites
laundry appliance 26 sites refrigeration appliance 16 sites
green appliances 29 sites innovative appliances 15 sites
Show more

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Favicon of fisherpaykelappliance.co.nz  

Fisherpaykelappliance.co.nz

Default Web Site Page

Almost every home in nz includes at least one fisher and paykel appliance. For generations fisher and paykel have been our most trusted brand of home appliances

Popularity: | Safety: | fisherpaykelappliance.co.nz tags for fisherpaykelappliance.co.nz fisher paykel / home appliances / laundry / oven / refrigerator / cooker / fisher &amp paykel / reviews

Favicon of fisherpaykeldishwasher.org  

Fisherpaykeldishwasher.org

Fisherpaykeldishwasher.org

A fisher paykel dishwasher can give the convenience and ease you’re looking for. This site has one of the most detailed fisher paykel dishwasher reviews you’ll see

Popularity: | Safety: | fisherpaykeldishwasher.org tags for fisherpaykeldishwasher.org dishwasher / dishwashers / things

Favicon of fisherpaykelapplianceservice.com  

Fisherpaykelapplianceservice.com

Appliance Service

Northwest appliance service company

Popularity: | Safety: | fisherpaykelapplianceservice.com tags for fisherpaykelapplianceservice.com appliance service / appliance repair service / washer service / dryer service / dryer repair service / microwave service / refrigerator service / refrigerator repair service / dishwasher service / service

Favicon of fisherpaykelappliancerepair.com  

Fisherpaykelappliancerepair.com

Fisher & Paykel Appliance Repair (617) 286 - 3170 | Refrigerator | Washer...

Fisher paykel appliance repair: active appliances serves the entire los angeles area with factory authorized and trained fisher paykel appliance repair technicians who stand behind our work

Popularity: | Safety: | fisherpaykelappliancerepair.com tags for fisherpaykelappliancerepair.com appliance / los angeles / santa clarita / appliance service and repair / active appliances / services / valley / santa / hills / city / park / west

Favicon of fisherpaykelalaska.com  

Fisherpaykelalaska.com

Bodis.com Acquires Trafficz.com

Popularity: | Safety: | fisherpaykelalaska.com tags for fisherpaykelalaska.com alaska

Favicon of fisherpaykelak.com  

Fisherpaykelak.com

Bodis.com Acquires Trafficz.com

Popularity: | Safety: | fisherpaykelak.com

Favicon of fisherpaykel-dishwasher.info  

Fisherpaykel-dishwasher.info

Fisherpaykel-dishwasher.info – このドメインはお名前.comで管理されています。

Popularity: | Safety: | fisherpaykel-dishwasher.info

Favicon of fisherpaykelappliances.co.nz  

Fisherpaykelappliances.co.nz

Kitchen & Laundry Appliances | Fisher & Paykel nz

Fisher&paykeldesignsandmanufacturespremiumaward-winninghomeappliances.browseourrangeandfindyournearestretailerinnewzealand

Popularity: | Safety: | fisherpaykelappliances.co.nz tags for fisherpaykelappliances.co.nz home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / kitchen / new zealand / fisher &amp paykel / kitchen appliances / fisher paykel / appliances / register / contact / laundry / story / store

Favicon of fisherpaykeldryersites0.co.cc  

Fisherpaykeldryersites0.co.cc

Www.fisherpaykeldryersites0.co.cc • Buy or Donate on Instagram

Popularity: | Safety: | fisherpaykeldryersites0.co.cc tags for fisherpaykeldryersites0.co.cc short links / tinyurl / bitly / bit.ly / earn money / link advertising / tiny url / screen capture

Favicon of fisherpaykelparts.com  

Fisherpaykelparts.com

Fisherpaykelparts.com is Expired

Letstalkparts.com is your one stop shop for fisher paykel appliance parts. We also carry u-line,viking, dcs and marvel parts and more

Popularity: | Safety: | fisherpaykelparts.com tags for fisherpaykelparts.com fisher paykel parts / fisher / list price / appliance / grill

Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

  • <a>image</a>( 77% )
  • fridge-freezer( 22% )

Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • <a>image</a>( 50% )
  • fridge-freezer( 50% )

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Fisherpaykel.co.nz is ranked 124,619th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 124,619 visit alexa Alexa backlinks: 59
This report show rough estimate of fisherpaykel.co.nz's popularity
The top queries driving traffic to www.fisherpaykel.co.nz from search engines.
fisher & paykel

Visitors Localization

Traffic Estimations Medium
Traffic Rank 124,619th most visited website in the World

Websites hosted on same IP

Favicon of www.fp.co.nz  

Fp.co.nz

Kitchen & Laundry Appliances | Fisher & Paykel nz

Fisher&paykeldesignsandmanufacturespremiumaward-winninghomeappliances.browseourrangeandfindyournearestretailerinnewzealand

Popularity: | Safety: | www.fp.co.nz tags for www.fp.co.nz home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / kitchen / new zealand / fisher &amp paykel / kitchen appliances / fisher paykel / appliances / innovation / register / contact / store / story / into

Favicon of www.fisherpaykel.ca  

Fisherpaykel.ca

Home, Kitchen & Laundry Appliances | Fisher & Paykel Canada

Fisher & paykel designs & manufactures award-winning home appliances. Our passion is creating better products that turn everyday routines into enjoyable experiences

Popularity: | Safety: | www.fisherpaykel.ca tags for www.fisherpaykel.ca home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / appliances / kitchen appliances / fisher paykel / innovation / product / store

Favicon of www.fisherpaykel.eu  

Fisherpaykel.eu

Home, Kitchen & Laundry Appliances | Fisher & Paykel Europe

Fisher & paykel designs & manufactures award-winning home appliances. Our passion is creating better products that turn everyday routines into enjoyable experiences

Popularity: | Safety: | www.fisherpaykel.eu tags for www.fisherpaykel.eu home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / kitchen / fisher &amp paykel / kitchen appliances / fisher paykel / innovation / product / store

Favicon of www.fisherpaykel.co.uk  

Fisherpaykel.co.uk

Buy Kitchen & Laundry Appliances Online | Fisher & Paykel uk

Fisher&paykeldesignsandmanufacturespremiumaward-winninghomeappliances.browseourrange,buydirectonlineorfindyournearestukdealer

Popularity: | Safety: | www.fisherpaykel.co.uk tags for www.fisherpaykel.co.uk home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / kitchen / fisher &amp paykel / united kingdom / kitchen appliances / fisher paykel / innovation / product / store

Favicon of www.fisherpaykel.asia  

Fisherpaykel.asia

Home, Kitchen & Laundry Appliances | Fisher & Paykel Asia

Fisher & paykel designs & manufactures award-winning home appliances. Our passion is creating better products that turn everyday routines into enjoyable experiences

Popularity: | Safety: | www.fisherpaykel.asia tags for www.fisherpaykel.asia home appliances / cooking appliance / laundry appliance / refrigeration appliance / dishdrawer® / ice & water / green appliances / innovative appliances / fisher & paykel appliances / kitchen / fisher &amp paykel / kitchen appliances / fisher paykel / innovation / product / store

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 2.51. The highest load time is 5.29, the lowest load time is 1.20, the average load time is 2.43.

Contact information:

http://www.fisherpaykel.co.nz/nz/company/about/ - Home & Kitchen Appliances - Fisher & Paykel Appliances New Zealand
http://www.fisherpaykel.co.nz/nz/support/contact-us/ - Home & Kitchen Appliances - Fisher & Paykel Appliances New Zealand
@FisherPaykelNZ - Fisher Paykel NZ (FisherPaykelNZ) в Твиттере
See fisherpaykel.co.nz contact information in whois record

0reviews

Add review