More tools
  • Whois Record
  • Reverse IP
  • Trace IP
  • Whois IP
  • What is my IP
  • Page Rank checker
  • Ping
  • Traceroute
  • Top Up Websites
  • Top Down Websites
Whois Record Trace IP
compare
Get a widget

Liveside.net

Microsoft Centric. Consumer focused. Independent news and information since 2006
advertising
Links Website Facebook Twitter >>
Website Topics microsoft, windows + 6 more>>
Top Keywords from Search Engines msn groups, livesite, mylive + 2 more>>
Liveside.net is ranked 2,225,186th in the world (amongst the 30 million domains). This site is estimated to be worth $6045. It has 40 backlinks. Liveside.net has 47% seo score.
Popularity: Safety: Social signals: Legit: legal

Similar websites

Favicon of windowsazure.com  

Windowsazure.com

Microsoft Azure: Cloud Computing Platform & Services

Microsoft azure is an open, flexible, enterprise - grade cloud computing platform.move faster, do more

Popularity: | Safety: | windowsazure.com tags for windowsazure.com azure / windows azure / microsoft azure / cloud computing

Favicon of microsoftstore.com  

Microsoftstore.com

Microsoft Store Online - Welcome

Shop for the latest software and technology products from microsoft store.experience the best of

Popularity: | Safety: | microsoftstore.com tags for microsoftstore.com windows / windows phone / office / buy microsoft office

Favicon of c-sharpcorner.com  

C-sharpcorner.com

c# Corner - a Social Community of Developers And Programmers

Community for developers and it professionals

Popularity: | Safety: | c-sharpcorner.com tags for c-sharpcorner.com azure / windows phone / windows / microsoft net

advertising
Favicon of microsoft.com  

Microsoft.com

Microsoft – Official Home Page

At microsoft our mission and values are to help people and businesses throughout the world realize their full potential

Popularity: | Safety: | microsoft.com tags for microsoft.com microsoft / windows / office / windows phone

Favicon of winsupersite.com  

Winsupersite.com

Supersite For Windows

Paul thurrott's news, articles, tips, commentaries, and reviews on microsoft technology - - windows

Popularity: | Safety: | winsupersite.com tags for winsupersite.com windows / windows phone / microsoft

Favicon of truecaller.com  

Truecaller.com

Truecaller

Truecaller is transforming today’s phonebook to make it more intelligent and useful

Popularity: | Safety: | truecaller.com tags for truecaller.com windows phone / windows mobile / number search / mobile phone

Favicon of office365.com  

Office365.com

Microsoft Office | Productivity Tools For Home & Office

From desktop to web for macs and pcs, office delivers the tools to get work done

Popularity: | Safety: | office365.com tags for office365.com office / cloud services / microsoft / online services

Favicon of shapingcloud.com  

Shapingcloud.com

Shaping Cloud - Welcome to The Intelligent Cloud

Microsoft cloud platform gold partners.we deliver modern api - first web and mobile software

Popularity: | Safety: | shapingcloud.com tags for shapingcloud.com windows / office / windows azure / microsoft cloud

Favicon of microsoftcloudshow.com  

Microsoftcloudshow.com

Microsoft Cloud Show

The only place to stay up to date on everything going on in the microsoft cloud world including azure

Popularity: | Safety: | microsoftcloudshow.com tags for microsoftcloudshow.com microsoft / azure / windows / office

Favicon of kapilarya.com  

Kapilarya.com

Windows Troubleshooting, How to Guides on Kapil Sparks™

Kapil sparks™ is a windows troubleshooting & how to tutorials blog from kapil arya

Popularity: | Safety: | kapilarya.com tags for kapilarya.com microsoft / windows / windows phone / windows 10

Trending related sites:

Domain Increase Popularuty
azure.com
739

Web Safety

liveside.net is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

General Statistics

Title: LiveSide.net
Description: Microsoft Centric. Consumer focused. Independent news and information since 2006
SEO score: 47%
Website Worth: $6,045 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 2,225,186
Alexa backlinks: 421
Webstatsdomain backlinks:
IP-address: 104.18.49.228 [Trace] [Reverse]
Pageviews per User: 1.1
Average Time on Site: 01:07
Search Percent:
Estimated percentage of visits to www.liveside.net that came from a search engine
45.5%
Bounce:
Estimated percentage of visits to www.liveside.net that consist of a single pageview
81.8%
Daily Pageviews: n\a
Load Time: 0.27 seconds

Website categories

Currently, we found 10 categories on liveside.net
microsoft 77'072 sites windows 332'925 sites
windows phone 11'491 sites search 529'649 sites
search engine 48'482 sites consumer 36'497 sites
Show more

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Favicon of www.livesicilia.it  

Livesicilia.it

Live Sicilia : Quotidiano Sicilia - Cronaca Sicilia...

Giornale di notizie di sicilia, cronaca di palermo e catania; politica, economia, sport, video, fotogallery e interviste

Popularity: | Safety: | www.livesicilia.it tags for www.livesicilia.it palermo / catania / sicilia / politica / economia / magazine / sport / video / meteo / tra / trapani / i video

Favicon of livesino.net  

Livesino.net

Livesino 中文版 - 微软资讯、观点、技巧博客

专注于报导微软(microsoft)产品资讯、体验、技巧和观点的博客媒体,关注微软 windows 8.1、windows phone 8 和 xbox 以及 outlook、skydrive。

Popularity: | Safety: | livesino.net tags for livesino.net microsoft / windows / threshold / windows 9 / windows threshold / wind / windows live / live / office live / blog / windows phone / nokia

Favicon of www.livesimon.com  

Livesimon.com

Baby Shower, Shower Curtains, Shower Doors, Shower Ideas - Livesimon...

Livesimon.com is a website about baby shower, shower curtains, shower doors, shower ideas. You can find and read the good information in here

Popularity: | Safety: | www.livesimon.com tags for www.livesimon.com designer shower curtains / frameless glass shower doors / walk in shower designs / sale services / personals / housing / events / jobs

Favicon of www.livesinthebalance.org  

Livesinthebalance.org

Lives in The Balance And Dr. Greene's Approach

Dr. Ross greene is the originator of the collaborative problem solving approach -- now called collaborative & proactive solutions -- as described in his books the explosive child, lost at school, lost & found, and raising human beings. he founded

Popularity: | Safety: | www.livesinthebalance.org tags for www.livesinthebalance.org balance / the balance

Favicon of www.livesinabox.com  

Livesinabox.com

Lives in a Box

Lives in a box is a personal collective of various projects including the friends fan site crazy for friends

Popularity: | Safety: | www.livesinabox.com tags for www.livesinabox.com box / friends

Favicon of livesinqatar.com  

Livesinqatar.com

Livesinqatar.com

This website is for sale! livesinqatar.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, livesinqatar.com has it all. We hope you find what you are se

Popularity: | Safety: | livesinqatar.com tags for livesinqatar.com jobs in qatar / jobs i / qatar / properties types / search / lives / views / jobs / sale

Favicon of livesimplylivethriftylivesavvy.com  

Livesimplylivethriftylivesavvy.com

Live Simply, Live Thrifty, Live Savvy | Life Lived Better

Popularity: | Safety: | livesimplylivethriftylivesavvy.com tags for livesimplylivethriftylivesavvy.com live / job

Favicon of www.livesigmakappa.com  

Livesigmakappa.com

Hugedomains.com - Livesigmakappa.com is For Sale (live Sigma Kappa)

Popularity: | Safety: | www.livesigmakappa.com tags for www.livesigmakappa.com sigma / sigma kappa / travel / pet

Favicon of www.livesimply.ie  

Livesimply.ie

Live Simply Private & Group Life Coaching.confidence & Self Esteem Specialists...

Popularity: | Safety: | www.livesimply.ie tags for www.livesimply.ie wordpress / just another wordpress / confidence / healthy / group / life

Favicon of livesinlit.com  

Livesinlit.com

Three Score & Ten

Popularity: | Safety: | livesinlit.com tags for livesinlit.com death

Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
omnia i micro usb
1 2016-02-12
windows live mail google contacts
1 2015-12-01
livedrive wayback
2 2016-02-05
windows live cloud
2 2016-01-02
xbox skype
2 2015-12-31
skype xbox
2 2015-12-11
windows live solution centre private forum
3 2016-01-29
bing 411
3 2015-12-07
windows live mail google contacts sync
3 2015-12-01
live msn messenger message reminder
4 2016-02-05

Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

  • liveside( 50% )
  • liveside.net( 30% )
  • www.liveside.net( 20% )

Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • liveside( 100% )

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Liveside.net is ranked 2,225,186th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 2,225,186 visit alexa Alexa backlinks: 421
This report show rough estimate of liveside.net's popularity
The top queries driving traffic to www.liveside.net from search engines.
rps token
delete windows 10 sync data
bing homepage aug 22 2016
mylive
how to remove microsoft account

Visitors Localization

Traffic Estimations Low
Traffic Rank 2,225,186th most visited website in the World

Websites hosted on same IP

Favicon of www.holdan.co.uk  

Holdan.co.uk

Holdan Limited - Broadcast And Video Technology From Holdan

Holdan limited - broadcast and video technology from holdan. Tapeless workflows, editing software, professional camcorders and media delivery tools

Popularity: | Safety: | www.holdan.co.uk tags for www.holdan.co.uk distributor / panasonic / avchd / blackmagic design / dma / focus enhancements / grass valley / hp / tv one / acquisition / live / production / post / editing / edit / hd / sd / content / storage / video / technology / product

Favicon of alimun.com  

Alimun.com

All Free Download Wallpaper | All Free Download Wallpaper

Popularity: | Safety: | alimun.com

Favicon of jasmineloves.com  

Jasmineloves.com

Hugedomains.com - Jasmineloves.com is For Sale (jasmine Loves)

A fashion and lifestyle blog with a little of what i love

Popularity: | Safety: | jasmineloves.com tags for jasmineloves.com fashion / ellenborough park / hotels / follow / room

Favicon of murderbirds.com  

Murderbirds.com

Murder Birds | Treasure Amongst Trash

Show and tell for idiot savants

Popularity: | Safety: | murderbirds.com tags for murderbirds.com web host / host / website hosting / webhosting / web hosting provider / doodles

Favicon of sat-outlet.info  

Sat-outlet.info

Registered at Namecheap.com

Pligg is an open source content management system that lets you easily <a href='http://www.pligg.com'>create your own social network</a>

Popularity: | Safety: | sat-outlet.info tags for sat-outlet.info news / articles / vote / publish / social / networking / groups / submit / upcoming / comments / tags / live / outlet / distribution amplifier

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.27. The highest load time is 1.43, the lowest load time is 0.22, the average load time is 0.56.

Contact information:

http://www.liveside.net/about/ - About at LiveSide.net
Facebook profile for www.liveside.net - LiveSide.net | Facebook
@WinBetaDotOrg - WinBeta (@WinBetaDotOrg) | Twitter
See liveside.net contact information in whois record

0reviews

Add review