Visit

Mapperleypark.co.uk

Get a widget

Welcome to Mapperley Park Training Academy, the UK’s leader in medical aesthetic training.

advertising
Popularity: Safety: Legit: legal Contact info: Contact page

Mapperleypark.co.uk Domain Statistics

Title:
Home - Mapperley Park Academy
Description:
Welcome to Mapperley Park Training Academy, the UK’s leader in medical aesthetic training.
SEO score:
28%
Website Worth:
$1,515 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank:
13,459,433
Alexa backlinks:
35
Webstatsdomain backlinks:
IP-address:
162.13.82.179 [Trace] [Reverse]
Pageviews per User:
3
Daily Pageviews:
n\a
Sites redirect to this site:
www.maperlypark.co.uk, www.mapperlypark.co.uk
Load Time:
2.28 seconds
Top Keywords from Search Engines:
hair removal centre, laser hair removal nottingham, cpd foundation, reserve your place, stretch marks removal surgery uk
Website Topics:
laser, tattoo removal, laser hair removal, cosmetic surgery, varicose veins, lines and wrinkles, hair transplants, dermal fillers, hair removal, fungal nail, skin health, maintenance, procedures
advertising

Mapperleypark.co.uk Contact information :

http://www.mapperleypark.co.uk/contact/ - Contact | Mapperley Park Clinic
Facebook profile for mapperleypark.co.uk - Mapperley Park Clinic - Ноттингем - Лазерное удаление волос | Facebook
https://plus.google.com/103475710125160671616/about - Mapperley Park Clinic - Nottingham - About - Google+
@MapperleyPark - MapperleyParkClinic (@MapperleyPark) | Твиттер
See mapperleypark.co.uk contact information in whois record

Web Safety

mapperleypark.co.uk is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Mapperleypark.co.uk is ranked 13,459,433rd in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 13,459,433 visit alexa Alexa backlinks: 35
This report show rough estimate of mapperleypark.co.uk's popularity
The top queries driving traffic to www.mapperleypark.co.uk from search engines.
cpd foundation
reserve your place

Mapperleypark.co.uk Visitors Localization

Traffic Estimations Low
Traffic Rank 13,459,433th most visited website in the World

Website categories

Currently, we found 13 categories on mapperleypark.co.uk
laser 47'054 sites tattoo removal 1'625 sites
laser hair removal 6'824 sites cosmetic surgery 7'516 sites
varicose veins 1'821 sites lines and wrinkles 36 sites
Show more

Mapperleypark.co.uk competitors

 

The Vein And Laser Clinic Tysons Corner, va | Serving Md, Dc...

Vein and laser clinic located in virginia serving maryland, washington dc and virginia all aspect

| | veinandlaserclinic.com

 

Cosmetic Enhancement Center of New England

Cosmetic enhancement center of new england is the premier destination for medical aesthetics in portland

| | cecofne.com

 

Laser Treatment Clinic|cosmetic Surgery Clinic|hair Removal Mumbai

Amritclinic - best laser treatment clinic in mumbai india for laser hair removal, stretch marks removal

| | amritclinic.com

 

Hair Transplant in Goa & Cosmetic Surgery| Loocs Cosmetic Clinic

Dr.avni pankar & dr.anand joshi expertise in cosmetic surgery & hair transplant in goa

| | loocscosmeticclinic.com

 

Aesthetic Art - Michigan Laser And Skin Care Center...

Hair removal, vein treatments, skin care and general dermatology

| | aestheticartbeauty.com

 

Home - Dermatologist, Mohs Skin Cancer, Laser Treatments...

Accredited dermatological surgeon in jupiter, fl specializing in skin care

| | jupiterderm.com

 

Aspire Cosmetic Clinic, Berkshire | Non-surgical Cosmetic Treatments

Aspire cosmetic clinic based in reading, berkshire offer non - surgical treatments and cosmetic procedures

| | aspireclinic.com

 

Cosmetic Dermatology Washington dc

The center for laser surgery is washington dc's leader in cosmetic dermatology, laser surgery

| | lasersurgery.com

 

Laser & Cosmetic Medicine in Hartford ct | Abbey Aesthetics

Abbey aesthetics offers a full range of treatments and procedures including laser hair, tattoo, vein

| | abbeyaesthetics.com

 

Home

The beauty systems of the beautytek family offer solutions for the tightening of tissue

| | beautytek.org

Mapperleypark.co.uk Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Mapperley Games

Mapperleygames.com

| | mapperleygames.com

 

Home · Mapperley Village History Project

Created by elaine sarson in memory of my husband roger sarson

| | mapperleyhistory.com

 

Mapperley Acupuncture | Sharing Tips Hidup Sehat Dengan Mapperley

Welcome to mapperley acupuncture, providing acupuncture in nottingham. With many years experience, your practitioner is nigel shipston

| | mapperleyacupuncture.com

 

Mapperleyelectricalservices.info

| | mapperleyelectricalservices.info

 

Mapperleyelectricalservices.org

| | mapperleyelectricalservices.org

 

Home

Default description

| | mapperleycc.org

 

Mapperley Community :: Home

| | mapperleycommunity.co.uk

 

Home

| | mapperleyparkopengardens.co.uk

Mapperleypark.co.uk Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
laser hair removal nottingham
8 2016-02-03
stretch marks removal surgery uk
12 2015-12-12
kenyon martin tattoo removal
12 2015-12-02
nottingham mole removal
13 2016-01-13
hair removal nottingham
14 2016-02-03
hair removal centre
15 2016-01-22
bmi park hospital nottingham
20 2015-12-10
accent radio frequency
23 2015-11-16
keloid scar removal nhs
26 2015-12-23
how much does dermology hair removal cream cost
26 2015-12-15

Mapperleypark.co.uk Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

  • <a>image</a>( 100% )

Mapperleypark.co.uk Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • <a>image</a>( 100% )

Mapperleypark.co.uk Websites hosted on same IP

 

Global Anglican Future | Gafcon

The official global anglican future conference website

| | www.gafcon.org

 

App Home - 4experience Virtual Reality Studio

4experience - virtual reality studio. the best choice for training, simulation, medicine, advertisement and entertainment

| | 4experience.co

 

Archangels - Investing in Innovation

We are a prominent business angel syndicate, which has been at the forefront of early stage investing in scotland for more than two decades. Our members invest in and mentor promising start-up and early stage companies from scotland’s vibrant techno

| | www.archangelsonline.com

 

Home - Personalised Christmas Sacks | Handmadechristmasco.com

Personalised and non personalised christmas sacks. The handmade christmas co. Strive to provide the perfect accompaniment to any family christmas, young or old

| | handmadechristmasco.com

 

Larissa Rosanoff, Lyric Soprano

Larissa rosanoff, lyric soprano

| | rosanoff.net

 

Club Cigare de Genève

Club dépicuriens amateurs de cigares ayant pour but la découverte et la dégustation de vitoles dans une ambiance amicale et conviviale

| | www.clubcigare.ch

Mapperleypark.co.uk Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 2.28. The highest load time is 2.28, the lowest load time is 0.65, the average load time is 0.94.

Whois Lookup For mapperleypark.co.uk

0reviews

Add review