Pacificfertility.ca
Fertility & Infertility Clinic in Metro Vancouver, BC, Canada. Specialists in IVF/ICSI Treatments, Fertility, Infertility, Prenatal + First Trimester Screening.
Pacificfertility.ca Domain Statistics
canada
Pacificfertility.ca competitors
Genesis Fertility Centre | Vancouver Ivf & Infertility Clinic
With some of the best independently verified success rates in canada, genesis has helped thousands of
|
|
genesis-fertility.com
Ivf Clinic, Fertility Clinic, Canada, Toronto, Mississauga
Newlife fertility provides a wide variety of infertility treatments such as in vitro fertilization (ivf)
|
|
newlifefertility.com
Ottawa Fertility Centre
The fertility centre at the university of ottawa specializes in in vitro fertilization
|
|
www.conceive.ca
Fertility Center : Dallas, Texas - (care) Center For Assisted Reproduction...
The center for assisted reproduction, a fertility center near dallas and fort worth, texas
|
|
www.embryo.net
Welcome to The Infertility Center of St. Louis
The infertility center of st.louis is a world leader in treating complex infertility problems
|
|
www.infertile.com
Ivf Centre in India, Best Infertility Treatment Delhi, Ivf Clinic In...
The best ivf centre india, fertility centre delhi, ivf clinic in delhi provides infertility treatment india
|
|
www.internationalfertilitycentre.com
Ivf Clinics | London Fertility Clinic | The Bridge Centre
Fertility clinic london, london fertility clinic, fertility clinics london, ivf clinics
|
|
www.thebridgecentre.co.uk
Invia Fertility Specialists | Chicago Fertility Clinic With 4 Locations...
Invia fertility is a leading chicago fertility clinic.our highly trained staff use the most up - to
|
|
www.inviafertility.com
Home - The Fertility Centerthe Fertility Center...
|
|
www.fertilitycentermi.com
Iswarya Fertility Centre - Best Infertility Treatment, Ivf Hospital Chennai...
Ivf, infertility treatment & fertility centre in chennai, coimbatore, madurai and palani
|
|
www.iswaryafertility.com
Pacificfertility.ca Sites with a similar domain name
We found 19 websites. With this list, you can understand how other people are using the domain, similar to yours.
Fertility Treatment & Ivf Center in San Francisco, California...
Leading international destination for infertility treatment including icsi, ivf - in vitro fertilization, pgd - preimplantation genetic diagnosis, egg donation, embryo freezing and other fertility treatments. visit the fertility specialists at pacific fe
|
|
pacificfertilitycenter.com
Pacific Festival
Pacific festival: the dunes, is a new entertainment experience for coastal orange county, benefiting surfrider foundation, happening on saturday, august 16, 2014 at the newport dunes waterfront resort and marina
|
|
pacificfestival.com
Pacific Fence & Wire Co. - Fence Installation, Portland, or
Pacific fence offers fence installation in portland, or and is a manufacturer and supplier of fence material including railings, gates, chain link, vinyl
|
|
pacificfence.com
オウンドメディアの詳細 オウンドメディアの詳細をわかりやすく解説しています
Resident ballet company of the thousand oaks civic arts plaza
|
|
pacificfestivalballetcompany.com
Welcome to The Pacific Fencing Club in Alameda, California
Pacific fencing club offers one of the most thorough introductory classes in fencing and is one of the oldest fencing clubs in the bay area
|
|
pacificfencingclub.com
Pacific Fertiliser Superior Products, Superior Results
|
|
pacificfertiliser.com
The Pacific Festival of The Book - Gateway
Victoria arts connection celebrates the literary arts with a unique interdisciplinary festival featuring: extensive trade show of book publishers, book sellers and related organizations and non-profit community groups, author talks & book signings, bo
|
|
pacificfestivalofthebook.com
Hugedomains.com - Pacificfeast.com is For Sale (pacific Feast)
Zeyn is perfect wordpress template for any website
|
|
pacificfeast.com
Share Documents And Files Online | Microsoft Office Live
Store and share document online and create a website with microsoft office live
|
|
pacificfenceomaha.com
Welcome to The Frontpage
Joomla! - the dynamic portal engine and content management system
|
|
pacificfern.com
Pacific Ferry
Pacific ferry
|
|
pacificferry.co.id
Pacific Fertility Associates - Website of Pacificfertilityassociates!
Pacific fertility associates has the experience and the expertise to administering cutting edge fertility treatments
|
|
pacificfertilityassociates.com
Pacific Ferromet Pvt Ltd
Pacific ferromet pvt ltd- manufacturers, suppliers, exporters & dealers in stainless steel pipes & tubes, buttweld fittings, stainless steel flanges, stainless steel forged pipe fittings, stainless steel sheets & plates, stainless steel round
|
|
pacificferromet.com
Pacific Fertility Egg Bank™ | Find Egg Donors...
Are you considering using donor eggs to become pregnant? pacific fertility egg bank™ provides a shorter and less expensive journey to your goal of parenthood. Find an egg donor today!
|
|
pacificfertilityeggbank.com
Pacific Fertility Center Reviews | Blog For Pacific Fertility Center...
|
|
pacificfertilitycenterreviews.com
Fertility Treatment & Ivf Center in San Francisco, California...
Leading international destination for infertility treatment including icsi, ivf - in vitro fertilization, pgd - preimplantation genetic diagnosis, egg donation, embryo freezing and other fertility treatments. visit the fertility specialists at pacific fe
|
|
pacificfertilityctr.com
my Site
See this go daddy instantpage! http://pacificfertilitycenters.net. Get yours free with a domain name at godaddy.com. This is my site description
|
|
pacificfertilitycenters.net
Default Parallels Plesk Panel Page
Leading international destination for infertility treatment including icsi, ivf - in vitro fertilization, pgd - preimplantation genetic diagnosis, egg donation, embryo freezing and other fertility treatments. visit the fertility specialists at pacific fe
|
|
pacificfertilitycenter.net
Cpanel®
|
|
pacificfederal.us
Pacificfertility.ca Domain Info
| Domain Name: | pacificfertility.ca |
| Domain Age: | 18 years and 11 months |
| See pacificfertility.ca whois information | |
Pacificfertility.ca Contact information :
http://pacificfertility.ca/contact
- Contact Us - Pacific Centre for Reproductive Medicine
|
https://plus.google.com/111836918632608602986?rel=author
- Ken Seethram - Google+
|
@PCRMedicine
- Pacific Reproductive (PCRMedicine) on Twitter
|
| See pacificfertility.ca contact information in whois record |
Web Safety
pacificfertility.ca is website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.
Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety
|
|
|
|---|---|
|
|
Is Pacificfertility.ca Legal or Not
| URLs Requested to be Removed: | 0 |
|---|---|
| Urls removed: | 0 |
| Percent: | 0% |
| Summary: | Pacificfertility.ca is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Pacificfertility.ca Visitors Localization
| Traffic Estimations | |
|---|---|
| Traffic Rank | 1,730,064th most visited website in the World |
| canada |
75.8 |
Website categories
| fertility clinic 325 sites | tubal ligation 73 sites |
| male infertility treatment 28 sites | fertility 6'150 sites |
| infertility clinic 123 sites | fertility ivf 25 sites |
Pacificfertility.ca Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
| Keyword | Position | Date |
|---|---|---|
| vancouver infertility | 1 | 2016-02-14 |
| morula stage embryo development | 3 | 2016-02-11 |
| pacific fertility | 5 | 2015-11-27 |
| morula stage on day 5 | 7 | 2016-02-11 |
| intrauterine insemination cost in canada | 7 | 2016-01-28 |
| amniocentesis cost of | 7 | 2015-12-14 |
| tubal ligation reversal cost in canada | 7 | 2015-12-13 |
| vasectomy vancouver | 9 | 2016-01-24 |
| ivf treatment cost | 10 | 2015-12-08 |
| ovidrel 250 and clomid 100 | 11 | 2016-01-24 |
Pacificfertility.ca Backlinks History
At the last check on 2018-08-16, we found 10 backlinks. The highest value is 10, the lowest value is 10, the average is 10.
Pacificfertility.ca Anchors Cloud
Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"
- pcrm
( 50% ) - pacific centre for reproductive medicine (pcrm( 50% )
Pacificfertility.ca Terms Cloud
List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"
- pcrm( 33% )
- pacific( 16% )
- centre( 16% )
- reproductive( 16% )
- medicine( 16% )
Pacificfertility.ca Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.12. The highest load time is 0.12, the lowest load time is 0.11, the average load time is 0.12.