More tools
  • Whois Record
  • Reverse IP
  • Trace IP
  • Whois IP
  • What is my IP
  • Page Rank checker
  • Ping
  • Traceroute
  • Top Up Websites
  • Top Down Websites
Whois Record Trace IP
compare
Get a widget

Parkwaychurch.tv

A church where people from all walks of life are discovering how to build their life to honor God.
advertising
Links Website >>
Website Topics service times, messages, events + 3 more>>
Top Keywords from Search Engines parkway + 4 more>>
Parkwaychurch.tv is ranked 15,967,500th in the world (amongst the 30 million domains). This site is estimated to be worth $934. It has 2 backlinks. Parkwaychurch.tv has 19% seo score.
Popularity: Safety: Social signals: Legit: legal

Similar websites

Favicon of www.celebrationpc.com  

Celebrationpc.com

Welcome to Celebration Church

Clecbration church is a ministry that cares about faith and building character and believing in jesus our lord

Popularity: | Safety: | www.celebrationpc.com tags for www.celebrationpc.com events / church / sunday service

Favicon of www.lwcworship.org  

Lwcworship.org

Home

This is a page giving you a quick introduction about dr.phil and marcia casterline.in addition

Popularity: | Safety: | www.lwcworship.org tags for www.lwcworship.org service times / living waters church / other events / church

Favicon of cbcomaha.org  

Cbcomaha.org

Community Bible Church | Omaha

We are a community of believers meeting at 90th & q street in omaha nebraska

Popularity: | Safety: | cbcomaha.org tags for cbcomaha.org events / church / worship service / community bible church

advertising
Favicon of www.corporatemusicdevelopment.co.uk  

Corporatemusicdevelopment.co.uk

Team Building, Corporate Events, Staff Motivation With Music

Team building with a difference, using music and to enhance staff communication

Popularity: | Safety: | www.corporatemusicdevelopment.co.uk tags for www.corporatemusicdevelopment.co.uk team building events / team building / corporate events

Favicon of www.mikesbremenserviceinc.com  

Mikesbremenserviceinc.com

Hvac Services in Orland Park, il | Mike’s Bremen Service

Let mike’s bremen service provide you with our quality orland park, il, hvac or heating and air conditioning services

Popularity: | Safety: | www.mikesbremenserviceinc.com tags for www.mikesbremenserviceinc.com home / park / tinley park

Favicon of www.seointeractivesolution.com  

Seointeractivesolution.com

+92-42-37186755 Call us For Business Promotion at Cheapest Rate

Give us a call : +92 - 42 - 37186755 for your business promotion at cheapest rate such as seo, smm, sem

Popularity: | Safety: | www.seointeractivesolution.com tags for www.seointeractivesolution.com affordable seo service / link building services / results / india

Favicon of newlookjanitorial.com  

Newlookjanitorial.com

New Look Janitorial Service, ‘we Can Make Your Place Sparkle!’ –miramar...

Janitorial/cleaning service, residential & commercial

Popularity: | Safety: | newlookjanitorial.com tags for newlookjanitorial.com service / building

Favicon of www.hautepursuit.co.uk  

Hautepursuit.co.uk

Corporate Conferences & Seminars, Gps Games, Ski Weekends...

The corporate events company.whether it’s a mountain based conference, corporate ski weekend in

Popularity: | Safety: | www.hautepursuit.co.uk tags for www.hautepursuit.co.uk events / home / event / building

Favicon of www.pointenorth.org  

Pointenorth.org

Pointe North Church | Home

Our vision - go therefore and make disciples of all nations, baptizing them inthe name of the fatherand

Popularity: | Safety: | www.pointenorth.org tags for www.pointenorth.org service times / church / service / ministries

Favicon of www.mountmoriahcc.org  

Mountmoriahcc.org

Mount Moriah Christian Church

Christian connection

Popularity: | Safety: | www.mountmoriahcc.org tags for www.mountmoriahcc.org home / building / church

Web Safety

parkwaychurch.tv is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

General Statistics

Title: Welcome to Parkway
Description: A church where people from all walks of life are discovering how to build their life to honor God.
SEO score: 19%
Website Worth: $934 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 15,967,500
Alexa backlinks: 2
Webstatsdomain backlinks:
IP-address: 66.132.241.171 [Trace] [Reverse]
Pageviews per User: 3
Average Time on Site: 09:35
Daily Pageviews: n\a
Sites redirect to this site: www.parkwayvictoria.org
Load Time: 0.93 seconds

Website categories

Currently, we found 7 categories on parkwaychurch.tv
service times 182 sites messages 32'969 sites
events 534'671 sites parkway 936 sites
building lives 10 sites celebrate recovery 279 sites
Show more

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Domain Popularity Safety
Favicon for parkwaychrysler.com   parkwaychrysler.com
Favicon for parkwaychryslerjeep.net   parkwaychryslerjeep.net
Favicon for parkwaychevrolet.com   parkwaychevrolet.com
Favicon for parkwaychristianacademy.org   parkwaychristianacademy.org
Favicon for parkwaychristian.org   parkwaychristian.org
Favicon for parkwaychryslerdealer.com   parkwaychryslerdealer.com
Favicon for parkwaychristianacademywildcats.com   parkwaychristianacademywildcats.com
Favicon for parkwaychristianchurch.org   parkwaychristianchurch.org
Favicon for parkwaychiropractic.com   parkwaychiropractic.com
Favicon for parkwaychryslerdodgejeep.com   parkwaychryslerdodgejeep.com

Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
parkway church
3 2016-02-13
wonder kids
25 2016-02-02

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Parkwaychurch.tv is ranked 15,967,500th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 15,967,500 visit alexa Alexa backlinks: 2
This report show rough estimate of parkwaychurch.tv's popularity
The top queries driving traffic to www.parkwaychurch.tv from search engines.
parkway church
parkway
the parkway church
parkway baptist church
victoria tx churches

Visitors Localization

Traffic Estimations Low
Traffic Rank 15,967,500th most visited website in the World

Websites hosted on same IP

Domain Popularity
Favicon for parkwayvictoria.org   www.parkwayvictoria.org
Favicon for parkwayvictoria.com   parkwayvictoria.com

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-09-05, website load time was 0.93. The highest load time is 1.62, the lowest load time is 0.43, the average load time is 0.77.

Contact information:

http://www.parkwaychurch.tv/pages/page.asp?page_id=159154 - Contact Us (Parkway Church)
See parkwaychurch.tv contact information in whois record

0reviews

Add review