More tools
  • Whois Record
  • Reverse IP
  • Trace IP
  • Whois IP
  • What is my IP
  • Page Rank checker
  • Ping
  • Traceroute
  • Top Up Websites
  • Top Down Websites
Whois Record Trace IP
compare
Get a widget

Portsmouthnaturalhistory.co.uk

Cumberland House Portsmouth Natural History Museum and
advertising
Links Website >>
Website Topics natural history, wildlife + 2 more>>
Top Keywords from Search Engines natural history museum + 4 more>>
Portsmouthnaturalhistory.co.uk is ranked 16,707,526th in the world (amongst the 30 million domains). This site is estimated to be worth $1432. It has 7 backlinks. Portsmouthnaturalhistory.co.uk has 31% seo score.
Popularity: Safety: Social signals: Legit: legal

Similar websites

Favicon of www.bexhillmuseum.co.uk  

Bexhillmuseum.co.uk

Bexhill on Sea Museum : Bexhill Museum Ltd

Bexhill museum is newly refurbished and extended, the displays and exhibitions have something for everyone to enjoy

Popularity: | Safety: | www.bexhillmuseum.co.uk tags for www.bexhillmuseum.co.uk natural history / local history

Favicon of www.cuba-museums-guide.com  

Cuba-museums-guide.com

Cuba Museums Guide - The Collection of Museums in Cuba.

In cuba museums guide you can check opening hours, special shows, entry fees or any other information

Popularity: | Safety: | www.cuba-museums-guide.com tags for www.cuba-museums-guide.com natural history museum / history / art museum

Favicon of santacruzcountymuseums.org  

Santacruzcountymuseums.org

Santa-cruz-county-museums-partnership-home

Santa cruz county hosts a diverse collection of history, nature and art museums

Popularity: | Safety: | santacruzcountymuseums.org tags for santacruzcountymuseums.org natural history museums / history museums / history / museum

advertising
Favicon of www.sofo.org  

Sofo.org

South Fork Natural History Museum & Nature Centersouth Fork Natural History Museum...

Sofo is a family - friendly natural history museum of exploration and discovery for children and adults

Popularity: | Safety: | www.sofo.org tags for www.sofo.org natural history museum / history / natural / museum

Favicon of www.mnhm.org  

Mnhm.org

Morrison Natural History Museum | Morrison, co - Official Website

Small museum, big discoveries - encounter fossils in hands - on exhibits with expert tours

Popularity: | Safety: | www.mnhm.org tags for www.mnhm.org natural history museum

Favicon of www.wmnh.com  

Wmnh.com

The Worldwide Museum of Natural History

Popularity: | Safety: | www.wmnh.com tags for www.wmnh.com natural history / museum

Favicon of museumofmilitaryhistory.com  

Museumofmilitaryhistory.com

Home

The museum of military history combines aspects of science, history, art, and anthropology museums

Popularity: | Safety: | museumofmilitaryhistory.com tags for museumofmilitaryhistory.com museum / military museum

Favicon of www.fileymuseum.co.uk  

Fileymuseum.co.uk

Filey Museum - Local History And Traditions

Filey museum offers an interesting insight into local history, traditions and customs

Popularity: | Safety: | www.fileymuseum.co.uk tags for www.fileymuseum.co.uk local history / museum / north riding

Favicon of malvernmuseum.co.uk  

Malvernmuseum.co.uk

Malvern Museum of Local History

Malvern museum manages to pack so much into the priory gatehouse to inform its visitors about malverns

Popularity: | Safety: | malvernmuseum.co.uk tags for malvernmuseum.co.uk history / museum

Favicon of www.museumwebsites.co.uk  

Museumwebsites.co.uk

Museum Websites - v And a, Transport, Maritime, Science And History Etc...

Websites of all the great british museums

Popularity: | Safety: | www.museumwebsites.co.uk tags for www.museumwebsites.co.uk history / museum / british museum / national museum

Web Safety

portsmouthnaturalhistory.co.uk is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Status:

Copy & paste code at your website:

just copy & paste the snippet into your website!

just copy & paste the snippet into your website!

General Statistics

Title: Cumberland House Natural History Museum
Description: Cumberland House Portsmouth Natural History Museum and
SEO score: 31%
Website Worth: $1,432 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank: 16,707,526
Alexa backlinks: 32
Webstatsdomain backlinks:
IP-address: 82.165.192.58 [Trace] [Reverse]
Pageviews per User: 1
Daily Pageviews: n\a
Sites redirect to this site: portsmouthnaturalhistorymuseum.com
Load Time: 6.97 seconds

Website categories

Currently, we found 6 categories on portsmouthnaturalhistory.co.uk
natural history 1'136 sites wildlife 28'030 sites
local history 999 sites portsmouth 7'248 sites
natural history museum 218 sites cumberland house 12 sites

Domain Name

Domain Name: www.portsmouthnaturalhistory.co.uk
Registrar: name: plogHost Web Services
Domain Age: 17 years and 8 months
See portsmouthnaturalhistory.co.uk whois information

Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

Favicon of portsmouthnavalmedicalcenterhousing.com  

Portsmouthnavalmedicalcenterhousing.com

Naval Medical Center Portsmouth, va Housing And Relocation Information...

Naval medical center portsmouth housing. Housing relocation information & real estate resources for naval medical center portsmouth, va

Popularity: | Safety: | portsmouthnavalmedicalcenterhousing.com tags for portsmouthnavalmedicalcenterhousing.com va / relocation / housing / military / real estate / mls / home / medical center housing / installations / apartments / rentals / homes

Favicon of portsmouthnavalshipyard.jobs  

Portsmouthnavalshipyard.jobs

Find Jobs. Quicker, Better, Smarter.

Portsmouthnavalshipyard.jobs is your source for portsmouthnavalshipyard career opportunities. Search millions of real-time portsmouthnavalshipyard job openings and read portsmouthnavalshipyard career/recruiting advice from industry experts. Portsmouthnava

Popularity: | Safety: | portsmouthnavalshipyard.jobs tags for portsmouthnavalshipyard.jobs portsmouth / jobs / jobs titles / company / north / city

Favicon of www.portsmouthnadfas.co.uk  

Portsmouthnadfas.co.uk

Sorry

The portsea island decorative and fine arts society is affiliated to nadfas

Popularity: | Safety: | www.portsmouthnadfas.co.uk tags for www.portsmouthnadfas.co.uk html / national / association / decorative / fine / arts / society / portsmouth / study days / decorative and fine arts / portsea island / arts society

Favicon of portsmouthnavalshipyardmuseum.com  

Portsmouthnavalshipyardmuseum.com

Portsmouth Virginia Naval Shipyard Museum | The Lightship Portsmouth...

Popularity: | Safety: | portsmouthnavalshipyardmuseum.com tags for portsmouthnavalshipyardmuseum.com portsmouth / virginia / naval museum / naval history / military history / portsmouth virginia

Favicon of portsmouthnappies.co.uk  

Portsmouthnappies.co.uk

Home Page

Popularity: | Safety: | portsmouthnappies.co.uk tags for portsmouthnappies.co.uk page / nappies

Favicon of portsmouthnaval.com  

Portsmouthnaval.com

Portsmouthnaval.com: The Leading Portsmouth Naval Site on The Net

Popularity: | Safety: | portsmouthnaval.com

Favicon of portsmouthnavalhomes.com  

Portsmouthnavalhomes.com

Portsmouthnavalhomes.com

Portsmouthnavalhomes.com

Popularity: | Safety: | portsmouthnavalhomes.com tags for portsmouthnavalhomes.com portsmouth

Favicon of portsmouthnavalshipyard.com  

Portsmouthnavalshipyard.com

Portsmouthnavalshipyard.com

Portsmouthnavalshipyard.com

Popularity: | Safety: | portsmouthnavalshipyard.com tags for portsmouthnavalshipyard.com searches job

Favicon of portsmouthnavalshipyardmilitaryfamilyhousing.com  

Portsmouthnavalshipyardmilitaryfamilyhousing.com

Balfour Beatty Communities

Popularity: | Safety: | portsmouthnavalshipyardmilitaryfamilyhousing.com tags for portsmouthnavalshipyardmilitaryfamilyhousing.com communities / balfour beatty communities

Favicon of portsmouthnazarene.org  

Portsmouthnazarene.org

Portsmouth (va) First Church of The Nazarene

Portsmouth (va) first church of the nazarene is located at 2512 barclay ave in portsmouth, va. We have ministries for all ages including children, youth, and adults. All are welcome to join us as we strive to know, love, and serve jesus christ

Popularity: | Safety: | portsmouthnazarene.org tags for portsmouthnazarene.org portsmouth

Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
national history musium
11 2016-01-22
porstmouth museums service
13 2016-02-01
natural histroy museum
17 2016-01-22
natural history museaum
21 2016-01-22

Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

Your site has high probability to get under the filter Google, which called Google penguin.

  • natural history museum » ( 50% )
  • <a>image</a>( 50% )

Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • natural( 20% )
  • history( 20% )
  • museum( 20% )
  • »( 20% )
  • <a>image</a>( 20% )

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Portsmouthnaturalhistory.co.uk is ranked 16,707,526th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 16,707,526 visit alexa Alexa backlinks: 32
This report show rough estimate of portsmouthnaturalhistory.co.uk's popularity
The top queries driving traffic to www.portsmouthnaturalhistory.co.uk from search engines.
natural history museum
butterfly
national history museum
portsmouth museum
natural history museum england

Visitors Localization

Traffic Estimations Low
Traffic Rank 16,707,526th most visited website in the World

Websites hosted on same IP

Favicon of www.ddaymuseum.co.uk  

Ddaymuseum.co.uk

D-day Museum And Overlord Embroidery

Commemorating d-day and the battle of normandy 1944

Popularity: | Safety: | www.ddaymuseum.co.uk tags for www.ddaymuseum.co.uk d-day museum / museum / th anniversary / portsmouth / normandy / museums / details / whats / news

Favicon of www.little-impressions.com  

Little-impressions.com

Baby Gift - Perfect And Unique Gifts From Little Impressions

Little impressions that last forever: beautiful baby gifts and baby imprints

Popularity: | Safety: | www.little-impressions.com tags for www.little-impressions.com unique gift / partners

Favicon of www.charlesdickensbirthplace.co.uk  

Charlesdickensbirthplace.co.uk

Charles Dickens Birthplace Museum

Charles dickens birthplace museum, celebrating 200th birthday at portsmouth, hants, hampshire

Popularity: | Safety: | www.charlesdickensbirthplace.co.uk tags for www.charlesdickensbirthplace.co.uk oliver twist / portsmouth museums / activities / one city / school

Favicon of www.southseacastle.co.uk  

Southseacastle.co.uk

Southsea Castle

Popularity: | Safety: | www.southseacastle.co.uk tags for www.southseacastle.co.uk castle / southsea castle

Favicon of www.tournerbury.com  

Tournerbury.com

Tournerbury Estate

Popularity: | Safety: | www.tournerbury.com tags for www.tournerbury.com news wedding / estate / venue / the

Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2017-08-01, website load time was 6.97. The highest load time is 8.65, the lowest load time is 5.95, the average load time is 7.21.

Contact information:

http://www.portsmouthnaturalhistory.co.uk/mvs@portsmouthcc.gov.uk - mvs@portsmouthcc.gov.uk
See portsmouthnaturalhistory.co.uk contact information in whois record

0reviews

Add review