Smadav adalah antivirus untuk proteksi tambahan komputer Anda, proteksi total USB Flashdisk, dan pembersihan tuntas virus yang menyebarluas.

UP

smadav.net is UP

Scanned: 2021-01-22
Popularity: Safety: Legit: legal Contact info: Contact page abuse@godaddy.com
advertising

Smadav.net Domain Statistics

Title:
Smadav Antivirus 2017 - Situs Resmi (Official) Smadav
Description:
Smadav adalah antivirus untuk proteksi tambahan komputer Anda, proteksi total USB Flashdisk, dan pembersihan tuntas virus yang menyebarluas.
SEO score:
62%
Website Worth:
$929,962 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank:
4,457
Primary Traffic:
The country where current domain is most popular relative to the other countries
indonesia
Alexa backlinks:
Webstatsdomain backlinks:
IP-address:
Date Registered
2008-08-03 05:05:16
Expires
2014-08-03 05:05:16
Site Age
12 years and 5 months
Email
Pageviews per User:
1.55
Average Time on Site:
02:02
Search Percent:
Estimated percentage of visits to www.smadav.net that came from a search engine
11.7%
Bounce:
Estimated percentage of visits to www.smadav.net that consist of a single pageview
50.8%
Daily Pageviews:
n\a
Sites redirect to this site:
virus4.com
Load Time:
0.26 seconds
advertising

Smadav.net competitors

 

Avast 2017 – The Best Free Antivirus For Windows pc

Avast antivirus 2017 is the best free antivirus for your pc running on windows 10, 8 or 7

| | www.getavast.net

 

Home - Enter Komputer

Official site enter komputer.best price, best service, best quality.location : mangga dua mall lt

| | www.enterkomputer.com

 

Driver Easy Free – 3,000,000+ Users Trusted Driver Updater

Driver easy is a driver updater for windows 7, 8.1, 10 & xp.update all drivers in one click.quickly

| | www.drivereasy.com

 

Adaware: The Best Free Antivirus & ad Block

Adaware is the internet’s security and privacy leader.we offer simple, worry

| | adaware.com

 

Devid.info – Free Driver Search And Update Utility

You can download drivers for your desktop pc, laptop or other device without a hitch

| | devid.info

 

Situs Resmi Pt.pelni (persero) -

Pelni, pelayaran, indonesia, kargo, kontainer, kapal, jadwal kapal, bongkar muat, pelabuhan

| | www.pelni.co.id

 

Download786.com

Here you can download and buy all types of software like fire wall, converter, anti virus

| | download786.com

 

Smadav Antivirus 2017

Download smadav gratis, smadav pro, key smadav, smadav gratis, smadav terbaru

| | smadav.web.id

 

Situs Resmi Anti Calon Gubernur Dki Jakarta 2012 - Fauzi Bowo...

Official web relawan bukan pendukung website resmi pendukung foke - nara

| | fokenara.wordpress.com

 

Situs Bola Resmi Indonesia - Selamat Datang di Blog Saya...

Selamatdatangdiblogsaya.disiniandaakanmendapatkaninformasisitusbolaresmiindonesia

| | dutonnerre.over-blog.com

Smadav.net Sites with a similar domain name

We found 17 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Forum Smadav - Indeks

Forum smadav - indeks

| | smadaver.com

 

Sma Negeri 2 Jombang | Just Another Wordpress Site

Schoolhos free open source cms

| | smadajo.org

 

Sma Negeri 2 Ngawi | , Think Globally Act Locally

Поиск информации в интернете: веб страницы, картинки, видео и многое другое

| | smada-ngawi.net

 

Smadakediri.info

| | smadakediri.info

 

Update Your Flash Player

Smadaprima.net

| | smadaprima.net

 

Smada Enterprises - Cheap School Books, Retailer of School Books Thatdeal...

In-school suspension student handbook i, in-school suspension student handbook student handbook ii, iss teacher manual,educational and guidance oriented posters

| | smadaenterprises.com

 

St. Mary of The Annunciation School

St. Mary of the annunciation school

| | smadanvers.org

 

Smadav Free

Smadav free is an official website of smadav antivirus providing the master of smadav antivirus to protect your system

| | smadavfree.com

 

Stella Maris Academy

| | smadavao.com

 

Smadav Pro

Smadav pro is the website to downoad smadav antivirus all version that will secure your computer

| | smadavpro.com

 

Smadav Free - Smadav Free Download

Smadav free download

| | smadavfree.net

 

Smadavantivirus.com

Smadavantivirus.com

| | smadavantivirus.com

 

Smadav2011.com

Smadav2011.com

| | smadav2011.com

 

Smadav Pro | Smadav Free Download Site

Smadavpro.net provide all version of smadav anti virus for computer and notebook users to download

| | smadavpro.net

 

Smadav Indonesia | Free Download Smadav Antivirus Indonesia

Smadavindonesia.com

| | smadavindonesia.com

 

Smada Consultants

| | smadaconsultants.com

Smadav.net Domain Info

Domain Name: smadav.net
Registrar: GoDaddy.com, LLC
Domain Age: 12 years and 5 months
See smadav.net whois information

Smadav.net Contact information :

Facebook profile for smadav.net - Smadav | Facebook
See smadav.net contact information in whois record

Web Safety

smadav.net is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Smadav.net is ranked 4,457th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 4,457 visit alexa Alexa backlinks: 5,111
This report show rough estimate of smadav.net's popularity
The top queries driving traffic to www.smadav.net from search engines.
smadav
smadav 2018
smadav pro
download smadav
smadav 2018 download

Smadav.net Visitors Localization

Traffic Estimations High
Traffic Rank 4,457th most visited website in the World
indonesia 27.9 nigeria 7.1
south africa 3.9 ethiopia 3.8

Website categories

Currently, we found 12 categories on smadav.net
smadav 461 sites antivirus 19'811 sites
anti virus 1'532 sites smadav pro 19 sites
smada 50 sites komputer anda 32 sites
Show more

Smadav.net Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
smadav anti virus
1 2016-02-15
antivirus indonesia
1 2016-02-03
antivirus lokal
1 2016-01-25
download antivirus smadav terbaru
1 2016-01-23
free download antivirus smadav
1 2016-01-15
antivirus lokal terbaik
1 2016-01-02
download smadav pro terbaru
1 2016-01-01
smadav pro
1 2015-12-30
smadav free
1 2015-12-19
antivirus smadav
1 2015-12-19

Smadav.net Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

Your site has high probability to get under the filter Google, which called Google penguin.

  • antivirus ( 32% )
  • smadav( 20% )
  • smadav antivirus( 16% )
  • www.smadav.net( 12% )
  • <a>image</a>( 12% )
  • http://www.smadav.net( 8% )

Smadav.net Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • antivirus( 40% )
  • smadav( 40% )
  • <a>image</a>( 20% )

Smadav.net Websites hosted on same IP

 

This Web Site Coming Soon

| | cardsselect.com

Smadav.net Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 0.26. The highest load time is 0.58, the lowest load time is 0.23, the average load time is 0.33.

Whois Lookup For smadav.net

0reviews

Add review