Washerdryerrepairs.org

Top washer and dryer repair company in Utah UT | we repair any appliance you own - washer, dryer, refrigerator, oven, ice maker, disposal, dishwasher, freezer

Popularity: Safety: Legit: legal Contact info: Contact page 15013018137@139.com
advertising

Washerdryerrepairs.org Domain Statistics

Title:
Washer Dryer Repair in Salt Lake | Refrigerator, Washer, Dryer
Description:
Top washer and dryer repair company in Utah UT | we repair any appliance you own - washer, dryer, refrigerator, oven, ice maker, disposal, dishwasher,... more
SEO score:
17%
Website Worth:
$343 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
IP-address:
0.0.0.0
Date Registered
2010-01-11 14:21:46
Expires
2013-01-11 04:59:59
Site Age
14 years and 3 months
Email
Owner
guang zhou shi du gao jing mi ji dian you xian gong si ( joe xie )
Daily Pageviews:
n\a
Contact information:
try to find contact info in whois information
advertising

Washerdryerrepairs.org competitors

 

Appliance Repair Forum

Appliancejunk.com - appliance repair forum

| | appliancejunk.com

 

Appliancerepairlesson.com

Diy appliance repair tips & tricks diy washer, dryer, refrigerator, microwave, dishwasher, oven, range

| | www.appliancerepairlesson.com

 

nj Appliance Repair Central And Southern nj Cities.refrigerator Repair...

Call apex appliance repair at 732 257 - 4590, serving monmouth, middlesex, ocean, union, essex, somerset

| | www.appliancerepairnewjersey.com

 

All Star Same Day Service - Phone 509 - 233 - 7365...

We are happy to service your appliance repair in spokane, wa.we offer remarkable quality of workmanship

| | www.appliancerepairspokanewa.com

 

Appliance Repair Company | la Fixit (877) 523 - 4923 Appliance Repair Los...

Residential and commercial appliance repair los angeles company.call (877) 523 - 4923 to repair

| | www.lafixit.com

 

Appliance Repair Chicago – Refrigerator Repair, Oven Repair, Washerrepair...

Appliance repair chicago – chicago area appliance repairs for refrigerator repair, oven repair

| | chicagoappliancerepairchicago.com

 

Appliance Repair in Rancho Santa fe ca

Appliance repair rancho santa fe ca we service refrigerators, freezers, ice makers, stoves, ovens

| | appliancerepairranchosantafe.com

 

Appliance Repair Service Everyday, Washers, Dryers, Refrigerators...

We are appliance repair and service.whirlpool, kenmore, sears, admiral, amana, caloric, estate

| | serviceeveryday.com

 

Quality Appliance Repair | Refrigerator Round Rock Texas | Washer Dryer Austin Tx...

We are the premier appliance repair service in austin texas.whether its a dishwasher, washing machine

| | www.qualityappliancerepairnow.com

 

Welcome to Emerald City Appliance Repair!

My wordpress blog

| | www.emeraldcityappliancerepair.com

Washerdryerrepairs.org Sites with a similar domain name

We found 20 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Washer Dryer Repair Help

Find many tutorials and videos for the do it yourself fix-it person all here and all free

| | washerdryerrepairhelp.com

 

Welcome to Windows Small Business Server 2003

Washer dryer repair can be an easy problem or a tough one depending on the type of person you arehere, we will help you fix your machine no matter which person you are

| | washerdryerrepair.org

 

Washer Dryer Repair Fort Worth, tx 817-617-9684

| | washerdryerrepairfortworth.net

 

Home

| | washerdryerrepairtampa.com

 

Los Angeles Washer Dryer Repair Guru #1 Appliance Repair in la Areawasher...

Los angeles washer dryer repair guru has been providing high-quality appliance repair service to the los angeles area for over three decades and is still #1

| | washerdryerrepairguru.com

 

Appliance Repair | Torrance & Manhattan Beach, ca

At a-west appliance repair & dryer vent cleaning in torrance, california, we provide fast appliance repair on your schedule. Our efficient repair technicians quickly diagnose the problem and fix your appliance

| | washerdryerrepairca.com

 

Holding Page For Washerdryerrepairwestpalmbeach.com Hibu.com

Home description

| | washerdryerrepairwestpalmbeach.com

 

Washerdryerrepairtucson

See this go daddy instantpage! http://washerdryerrepairtucson.com. Get yours free with a domain name at godaddy.com. Washer dryer repair in tucson, az

| | washerdryerrepairtucson.com

 

Temporarily Disabled

| | washerdryerrepairminneapolis.net

 

Temporarily Disabled

| | washerdryerrepairhouston.com

 

Hibu

Home description

| | washerdryerrepairatlanta.com

 

Appliance Parts And Repair Shop Fort Worth, tx ( Texas )

Accent appliance parts & service offers quality appliance parts and repair services to fort worth, tx. In-home service available. Call 817-244-5404

| | washerdryerrepairfortworth.com

 

Hibu

Factory-authorized parts and repair. Gulf coast appliance repair and parts center provides refrigerators, freezers and stoves to fort myers, fl. 239-947-1216

| | washerdryerrepairfortmyers.com

 

Mecklenburg County Appliance Repair, Refrigerator Repair Davidson County...

Appliance repair service serving mecklenburg, davidson, forsyth, guilford, alamance, randolph, cabarrus, catawba and rowan counties including washer, dryer, refrigerator, oven and dishwasher repair services

| | washerdryerrepairfayetteville.com

 

Washer Repairs by Fairfax va Appliances Repair : ge Washers, Maytag Washers...

Fairfax va appliances repair is a one stop repair center for all of your home appliances repair needs. If you are facing troubles with your washer, we fix all brands that you may have. Call us now on 000-000-0000 and get the best repair services in fairfa

| | washerdryerrepair-fairfaxva.com

 

Washer Dryer Repair Los Angeles (424) 299 - 4505 | Laundry Repair Los...

Washer dryer repair los angeles (424) 299-4505. La laundry washing machine and dryer repair service center. Local los angeles washer dryer repair service company

| | washerdryerrepairlosangeles.com

 

Washerdryerrepairchicago.com

Find washer repair, appliance repair and more at washerdryerrepairchicago.com. Get the best of air conditioner repair or refrigerator repair, browse our section on whirlpool washer repair or learn about lg washer repair. Washerdryerrepairchicago.com is th

| | washerdryerrepairchicago.com

 

Washer Dryer Repair Ft. Worth, Tx.

| | washerdryerrepairftworth.com

Washerdryerrepairs.org Domain Info

Domain Name: washerdryerrepairs.org
Registrar: HICHINA ZHICHENG TECHNOLOGY LIMITED
Domain Age: 14 years and 3 months
See washerdryerrepairs.org whois information

Web Safety

washerdryerrepairs.org is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Washerdryerrepairs.org Visitors Localization

Traffic Estimations Low
Traffic Rank No data available for this site. most visited website in the World

Website categories

Currently, we found 3 categories on washerdryerrepairs.org
repair 133'196 sites washer dryer repair 41 sites
dryer repair services 20 sites

Whois Lookup For washerdryerrepairs.org

0reviews

Add review