Visit

Mapperleygolfclub.org

Get a widget

Home | Mapperley Golf Club :: Nottinghamshire

advertising
Popularity: Safety: Legit: legal Contact info: Contact page yasirutomomn@gmail.com

Mapperleygolfclub.org Domain Statistics

Title:
Home | Mapperley Golf Club :: Nottinghamshire
SEO score:
20%
Website Worth:
$1,412 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Alexa Rank:
7,819,677
Alexa backlinks:
9
Webstatsdomain backlinks:
IP-address:
88.150.170.159
Date Registered
2011-11-07 05:00:00
Expires
2012-11-07 05:00:00
Site Age
7 years and 8 months
Email
Owner
Katakan Hey ( Yasir Utomo Muhammad Nur BTN Mangga 3 Blok G.7 No. 12 )
Pageviews per User:
4
Average Time on Site:
05:09
Daily Pageviews:
n\a
Load Time:
11.13 seconds
Top Keywords from Search Engines:
mapperley, golf clubs nottinghamshire, notts pga, golf lessons nottingham, alfreton golf club review
Website Topics:
golf course, golf, club, golf club, 18 hole, mapperley
advertising

Mapperleygolfclub.org Domain Info

Domain Name: mapperleygolfclub.org
Registrar: TUCOWS, INC
Domain Age: 7 years and 8 months
See mapperleygolfclub.org whois information

Mapperleygolfclub.org Contact information :

http://mapperleygolfclub.org/contact.htm - Mapperley Golf Club - Call 0115 955 6672
Facebook profile for mapperleygolfclub.org - Mapperley Golf Club - Nottingham - Sport/Erholung/Aktivitäten | Facebook
@mapperleygolf - Mapperley Golf Club (@MapperleyGolf) | Twitter
See mapperleygolfclub.org contact information in whois record

Web Safety

mapperleygolfclub.org is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Alexa traffic graph

Alexa traffic rank shows the popularity of your site relative to other sites. Mapperleygolfclub.org is ranked 7,819,677th in the world (among the 30 million domains). A low-numbered rank means that your website gets a lot of visitors.

Alexa rank: 7,819,677 visit alexa Alexa backlinks: 9
This report show rough estimate of mapperleygolfclub.org's popularity
The top queries driving traffic to www.mapperleygolfclub.org from search engines.
mapperley
whole in one golf
captain charity
mapperley nottingham
golf courses near me

Mapperleygolfclub.org Visitors Localization

Traffic Estimations Low
Traffic Rank 7,819,677th most visited website in the World

Website categories

Currently, we found 6 categories on mapperleygolfclub.org
golf course 13'103 sites golf 124'172 sites
club 244'334 sites golf club 8'282 sites
18 hole 157 sites mapperley 71 sites

Mapperleygolfclub.org competitors

 

Madison Golf And Country Club - Madison Golf & Country Club Home

The madison golf & country club (mcc) is a great golf course located close to madison, sd, featuringan 18

| | madisongolfsd.com

 

West Lancashire Golf Club : West Lancashire Golf Club - Club View

North west and merseyside championship links golf course in lancashire

| | westlancashiregolf.co.uk

 

Home | Coxmoor Golf Club :: Sutton-in-ashfield, Nottinghamshire

Heathland course in nottinghamshire which has hosted qualifying events for the open championship

| | coxmoorgolfclub.co.uk

 

Home : : Little Aston Golf Club uk – a Top 100 Golf Course...

Little aston golf club is a top 100 golf course in the uk.one of the best golf clubs in the west midlands

| | littleastongolf.co.uk

 

Kinloch Golf Club - Kinloch Golf Club - Home

Kinloch golf clubdedicated to providing members and guests a premier golf experience with world class

| | kinlochgolfclub.com

 

Ham Manor Golf Club :: Welcome to Ham Manor Golf Club

Ham manor golf club home page

| | hammanor.co.uk

 

Home | The Leicestershire Golf Club

The leicestershire golf club founded in 1890 is a beautiful parkland course which welcomes visitorsand societies

| | theleicestershiregolfclub.co.uk

 

South Texas Golf | Pleasanton Country Club | River Bend Golf Club...

Two 18 hole championship golf courses, just south of san antonio, tx.open to the public

| | southtxgolf.com

 

Home | Ryton Golf Club : : Tyne And Wear, North East England...

18 hole golf course located in the picturesque and historic heart of the tyne valley

| | rytongolfclub.co.uk

Mapperleygolfclub.org Sites with a similar domain name

We found 10 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Mapperley Games

Mapperleygames.com

| | mapperleygames.com

 

Home - Mapperley Park Academy

Welcome to mapperley park training academy, the uk’s leader in medical aesthetic training

| | mapperleypark.co.uk

 

Home · Mapperley Village History Project

Created by elaine sarson in memory of my husband roger sarson

| | mapperleyhistory.com

 

Pta Home Page

| | mapperleyplains.co.uk

 

Cheap Boots & Sandals For Womens Sale | Best Fashion Shoes And Footwear...

Shop for cheap shoes & footwear? we have great 2016 women/mens shoes on sale. Buy cheap shoes online at mapperleypetsandgardens.co.uk today!

| | mapperleypetsandgardens.co.uk

 

Mapperley Community :: Home

| | mapperleycommunity.co.uk

 

Home

Default description

| | mapperleycc.org

 

Mapperleyelectricalservices.org

| | mapperleyelectricalservices.org

 

Mapperleyelectricalservices.info

| | mapperleyelectricalservices.info

 

Mapperley Acupuncture | Sharing Tips Hidup Sehat Dengan Mapperley

Welcome to mapperley acupuncture, providing acupuncture in nottingham. With many years experience, your practitioner is nigel shipston

| | mapperleyacupuncture.com

Mapperleygolfclub.org Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
golf clubs nottinghamshire
6 2015-12-21
notts pga
9 2016-01-02
golf lessons nottingham
14 2016-01-12
alfreton golf club review
24 2015-12-16
alfreton golf club prices
25 2015-12-16

Mapperleygolfclub.org Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2017-09-08, website load time was 11.13. The highest load time is 13.11, the lowest load time is 6.12, the average load time is 8.92.

Whois Lookup For mapperleygolfclub.org

0reviews

Add review